Home » PDAP1 » PDAP1 Antibodies » PDAP1 Antibody

PDAP1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunocytochemistry/ Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRRERE
Specificity
Specificity of human PDAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDAP1 Protein (NBP2-38621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDAP1 Antibody

  • HASPP28
  • PAP1PDGFA-associated protein 1
  • PAP28 kDa heat- and acid-stable phosphoprotein
  • PDGFA associated protein 1
  • PDGF-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC

Puromycin-sensitive am ...
6410-ZN
Puromycin-sensitive aminopeptidase/NPEPPS
(1 Publication)
Species: Hu
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3].
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western blot shows human plasma. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Protein S/PROS1 at approximately 80 & 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows human plasma, loaded at 0.2 mg/mL. A specific band was detected for Protein S/PROS1 at approximately 106 kDa (as indicated) using 2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: WB, Simple Western
PLAG1 Antibody
(3B7)
H00005324-M02
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa).
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
(6 Publications)
Species: Hu
Applications: WB, ELISA, IHC
PDXP Antibody
NBP2-27461
Western Blot: PDXP Antibody [NBP2-27461] - 0.1 ug/ml staining of Mouse (A) and Rat (B) Brain lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: PDXP Antibody [NBP2-27461] - 5ug/ml staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer Ph 6, AP-staining.
Western Blot: PDXP Antibody [NBP2-27461] - NBP2-27461 (0.1ug/ml) staining of Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
CD155/PVR Antibody
(300907) [Unconjugate ...
MAB25301
U937 human histiocytic lymphoma cell line was stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
HUVEC human umbilical vein endothelial cells were stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CD155/PVR was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
PRH2 Protein
H00005555-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
PAPD1 Antibody
(3D2)
NBP2-43679
Western Blot: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of 30 ug whole cell lysate. A: A549 B: H1299 C: HCT116 D: MCF-7 7.5% SDS PAGE diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of methanol-fixed HeLa, using mtPAP antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of Hepatoma, using mtPAP antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
46420002
ELISA: TAT Antibody [46420002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
Serpin E1/PAI-1
Antibody
NBP1-19773
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Immunocytochemistry/Immunofluorescence: Serpin E1/PAI-1 Antibody [NBP1-19773] - PAI1/Serpine1 antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: Serpin E1/PAI-1 Antibody [NBP1-19773] - Staining of PAI1/Serpine 1 in mouse pancreas.
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
CEACAM5/CD66e
Antibody (487609) [Un ...
MAB41281
HEK293 human embryonic kidney cell line transfected with either (A) human CEACAM-5/CD66e or (B) humanCEACAM-8/CD66b and eGFP was stained with Mouse Anti-Human CEACAM‑5/CD66e Monoclonal Antibody (Catalog # MAB41281) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). Quadrant markers were set based on control antibody staining (Catalog # MAB003).
CEACAM‑5/CD66e was detected in immersion fixed paraffin-embedded sections of human colon using Mouse Anti-Human CEACAM‑5/CD66e Monoclonal Antibody (Catalog # MAB41281) at 10 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
CEACAM7 Antibody
[Unconjugated]
AF4478
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Recombinant Human
PSG2 Protein
H00005670-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Western Blot: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pancreatic Amylase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pancreatic Amylase.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded ovary using anti-Pancreatic Amylase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Pancreatic Amylase Alpha Antibody (6D4) [NBP1-47659] - Pancreatic Amylase Alpha Antibody (6D4) Staining of paraffin-embedded Adenocarcinoma of breast using anti-Pancreatic Amylase mouse monoclonal antibody.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
PDAP1 Antibody
NBP2-38621
PDAP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PDAP1 Antibody (NBP2-38621) (0)

There are no publications for PDAP1 Antibody (NBP2-38621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDAP1 Antibody (NBP2-38621) (0)

There are no reviews for PDAP1 Antibody (NBP2-38621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDAP1 Antibody (NBP2-38621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PDAP1 Antibody (NBP2-38621)

Discover related pathways, diseases and genes to PDAP1 Antibody (NBP2-38621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDAP1 Antibody (NBP2-38621)

Discover more about diseases related to PDAP1 Antibody (NBP2-38621).
 

Pathways for PDAP1 Antibody (NBP2-38621)

View related products by pathway.

PTMs for PDAP1 Antibody (NBP2-38621)

Learn more about PTMs related to PDAP1 Antibody (NBP2-38621).

Blogs on PDAP1

There are no specific blogs for PDAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDAP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDAP1
Uniprot