PDAP1 Antibody

Images

 
Western Blot: PDAP1 Antibody [NBP1-55238] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDAP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PDAP1(PDGFA associated protein 1) The peptide sequence was selected from the N terminal of PDAP1. Peptide sequence MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PDAP1 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
PDAP1 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDAP1 Antibody

  • HASPP28
  • PAP1PDGFA-associated protein 1
  • PAP28 kDa heat- and acid-stable phosphoprotein
  • PDGFA associated protein 1
  • PDGF-associated protein

Background

PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-69571
Species: Mu
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33012
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55238
Species: Hu
Applications: WB

Publications for PDAP1 Antibody (NBP1-55238) (0)

There are no publications for PDAP1 Antibody (NBP1-55238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDAP1 Antibody (NBP1-55238) (0)

There are no reviews for PDAP1 Antibody (NBP1-55238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDAP1 Antibody (NBP1-55238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDAP1 Products

Bioinformatics Tool for PDAP1 Antibody (NBP1-55238)

Discover related pathways, diseases and genes to PDAP1 Antibody (NBP1-55238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDAP1 Antibody (NBP1-55238)

Discover more about diseases related to PDAP1 Antibody (NBP1-55238).
 

Pathways for PDAP1 Antibody (NBP1-55238)

View related products by pathway.

PTMs for PDAP1 Antibody (NBP1-55238)

Learn more about PTMs related to PDAP1 Antibody (NBP1-55238).

Blogs on PDAP1

There are no specific blogs for PDAP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDAP1
Uniprot
Novus 100% Guarantee