PCYT2 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human gastrointestinal, kidney, liver and testis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: PCYT2 Antibody [NBP1-83951] - Analysis using Anti-PCYT2 antibody NBP1-83951 (A) shows similar pattern to independent antibody NBP1-83952 (B).
Immunocytochemistry/ Immunofluorescence: PCYT2 Antibody [NBP1-83951] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PCYT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCYT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
PCYT2 Protein (NBP1-83951PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCYT2 Antibody

  • CTP:phosphoethanolamine cytidylyltransferase
  • EC 2.7.7
  • EC 2.7.7.14
  • ET
  • ethanolamine-phosphate cytidylyltransferase
  • PCYT2
  • phosphate cytidylyltransferase 2, ethanolamine
  • Phosphorylethanolamine transferase

Background

ECT (ethanolamine phosphate cytidyltransferase) is an important regulatory enzyme in the pathway for phosphatidylethanolamine (PE) biosynthesis. PE functions in cell signalling, membrane fusion, platelet activation, and cell cycle progression. Specialized forms of PE exist as plasmologens, natural cannabinoid anadimade, and glycosylated PE. The ECT enzyme acts in the second of three catalysis steps to produce CDP-ethanolamine from phosphoethanolamine (P-Etn). Study of ECT could help determine the role of plasmologens in disease, specifically lipid disorders such as peroxisomal diseases as well as neuronal degeneration associated with Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCYT2 Antibody (NBP1-83951) (0)

There are no publications for PCYT2 Antibody (NBP1-83951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYT2 Antibody (NBP1-83951) (0)

There are no reviews for PCYT2 Antibody (NBP1-83951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCYT2 Antibody (NBP1-83951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYT2 Products

Research Areas for PCYT2 Antibody (NBP1-83951)

Find related products by research area.

Blogs on PCYT2

There are no specific blogs for PCYT2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYT2