PCYT2 Antibody

Images

 
Western Blot: PCYT2 Antibody [NBP1-83951] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PCYT2 Antibody [NBP1-83951] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: PCYT2 Antibody [NBP1-83951] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCYT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCYT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCYT2 Protein (NBP1-83951PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCYT2 Antibody

  • CTP:phosphoethanolamine cytidylyltransferase
  • EC 2.7.7
  • EC 2.7.7.14
  • ET
  • ethanolamine-phosphate cytidylyltransferase
  • phosphate cytidylyltransferase 2, ethanolamine
  • Phosphorylethanolamine transferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCYT2 Antibody (NBP1-83951) (0)

There are no publications for PCYT2 Antibody (NBP1-83951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYT2 Antibody (NBP1-83951) (0)

There are no reviews for PCYT2 Antibody (NBP1-83951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCYT2 Antibody (NBP1-83951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYT2 Products

Bioinformatics Tool for PCYT2 Antibody (NBP1-83951)

Discover related pathways, diseases and genes to PCYT2 Antibody (NBP1-83951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYT2 Antibody (NBP1-83951)

Discover more about diseases related to PCYT2 Antibody (NBP1-83951).
 

Pathways for PCYT2 Antibody (NBP1-83951)

View related products by pathway.

PTMs for PCYT2 Antibody (NBP1-83951)

Learn more about PTMs related to PCYT2 Antibody (NBP1-83951).

Blogs on PCYT2

There are no specific blogs for PCYT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYT2