![Western Blot: PCYOX1 Antibody [NBP2-88022] - WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate](http://images.novusbio.com/fullsize/PCYOX1-Antibody-Western-Blot-NBP2-88022-img0003.jpg "Western Blot: PCYOX1 Antibody [NBP2-88022] - WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | Novus Biologicals Rabbit PCYOX1 Antibody - BSA Free (NBP2-88022) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PCYOX1. Peptide sequence: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCYOX1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22678.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22679.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22682.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCYOX1 |
![Immunohistochemistry-Paraffin: PCYOX1 Antibody [NBP2-88022] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/PCYOX1-Antibody-Immunohistochemistry-Paraffin-NBP2-88022-img0002.jpg "Immunohistochemistry-Paraffin: PCYOX1 Antibody [NBP2-88022] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![Immunohistochemistry: PCYOX1 Antibody [NBP2-88022] - Human Liver](http://images.novusbio.com/fullsize/PCYOX1-Antibody-Immunohistochemistry-NBP2-88022-img0001.jpg "Immunohistochemistry: PCYOX1 Antibody [NBP2-88022] - Human Liver")
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R3_AF743_Flow_Cytometry_15754.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325571.jpg)
![Immunocytochemistry/ Immunofluorescence VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af743_mouse-vegf-r3-flt-4-affinity-purified-polyclonal-ab-41202410325534.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
