PCNA Antibody


Western Blot: PCNA Antibody [NBP1-89434] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: MOLT-4
Immunocytochemistry/ Immunofluorescence: PCNA Antibody [NBP1-89434] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Staining of human rectum shows strong nuclear positivity in subsets of glandular cells.
Simple Western: PCNA Antibody [NBP1-89434] - Simple Western lane view shows a specific band for PCNA in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: PCNA Antibody [NBP1-89434] - Electropherogram image of the corresponding Simple Western lane view. PCNA antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

PCNA Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMS
Proliferation Marker
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
PCNA Protein (NBP1-89434PEP)

Alternate Names for PCNA Antibody

  • cyclin
  • DNA polymerase delta auxiliary protein
  • MGC8367
  • proliferating cell nuclear antigen


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PCNA Antibody (NBP1-89434) (0)

There are no publications for PCNA Antibody (NBP1-89434).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCNA Antibody (NBP1-89434) (0)

There are no reviews for PCNA Antibody (NBP1-89434). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCNA Antibody (NBP1-89434) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PCNA Antibody Products

Related Products by Gene

Bioinformatics Tool for PCNA Antibody (NBP1-89434)

Discover related pathways, diseases and genes to PCNA Antibody (NBP1-89434). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCNA Antibody (NBP1-89434)

Discover more about diseases related to PCNA Antibody (NBP1-89434).

Pathways for PCNA Antibody (NBP1-89434)

View related products by pathway.

PTMs for PCNA Antibody (NBP1-89434)

Learn more about PTMs related to PCNA Antibody (NBP1-89434).

Blogs on PCNA.

The relationship between Ki67 and HIF-1 in cancer
Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life.  First discovered to be located to dividing cells,...  Read full blog post.

Caspase 3 - a Reliable Marker for Index of Apoptosis Induction
Caspase-3 is one of the most important players in apoptosis signaling. It is synthesized as an inactive 32 kDa pro-enzyme and upon direct activation by Caspase-8, -9 or -10, it gets processed into its active forms, the p17-20 and p10-12 subunits. T...  Read full blog post.

PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein)
PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl...  Read full blog post.

PCNA Antibodies: Marking Cell Proliferation & DNA Replication
Proliferating Cell Nuclear Antigen (PCNA), also known as the polymerase delta auxiliary protein, is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It has a large role in cell cycle regulation and...  Read full blog post.

PCNA is a Universal Marker of Proliferating Cells
Proliferating cell nuclear antigen (PCNA) is an evolutionarily well-conserved protein found in all eukaryotic species as well as in Archaea. PCNA was first shown to be involved in DNA replication. However PCNA functions are associated with other vital...  Read full blog post.

Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol PCNA

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89434 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought