PCNA Antibody

Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Analysis in human lymph node and liver tissues using NBP1-89434 antibody. Corresponding PCNA RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: PCNA Antibody [NBP1-89434] - Staining of human colon shows strong nuclear positivity in glandular cells.

Simple Western: PCNA Antibody [NBP1-89434] - Simple Western lane view shows a specific band for PCNA in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PCNA Antibody [NBP1-89434] - Electropherogram image of the corresponding Simple Western lane view. PCNA antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Analysis using NBP1-89434 (A) shows similar pattern to independent antibody NBP1-89504 (B).

Staining of human colon, liver, lymph node and testis using NBP1-89434 (A) shows similar protein distribution across tissues to independent antibody NBP1-89504 (B).

Product Discontinued

PCNA Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMS
• Marker: Proliferation Marker
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCNA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:25
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30257350).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCNA Antibody

• cyclin
• DNA polymerase delta auxiliary protein
• MGC8367
• PCNA
• proliferating cell nuclear antigen

Background

Proliferating Cell Nuclear Antigen (PCNA) is a DNA polymerase that is essential for DNA replication, excision and mismatch repair pathways. PCNA is a "DNA clamp" which binds to the CDK inhibitor p21, the structure-specific endonucleases Fen1 and XPG, and DNA cytosine 5-methyltransferase (MCMT). PCNA is a potentially useful marker of cells with proliferative potential and for identifying the proliferation status of tumor tissue (i.e. relevant to prognosis). PCNA antibodies are also useful tools for DNA repair and cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCNA Antibody (NBP1-89434)(3)

Publications using NBP1-89434

• Salim E, Mahfouz M, Eltonouby E et al. Based polymer nanoparticles from bee pollen attenuate non-small lung cancer through enhancement of apoptosis and cell cycle arrest in vivo Research Square 2023-05-04
• Hou X, Dai H, Zheng y Circular RNA hsa_circ_0008896 accelerates atherosclerosis by promoting the proliferation, migration and invasion of vascular smooth muscle cells via hsa-miR-633/CDC20B (cell division cycle 20B) axis Bioengineered 2022-03-01 [PMID: 35212610] (WB, Human)
• Yang C, Guo Y, Huang TS et al. Asiatic acid protects against cisplatin-induced acute kidney injury via anti-apoptosis and anti-inflammation. Biomed. Pharmacother. 2018-11-01 [PMID: 30257350] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: PCNA