PCIF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli, cytoskeleton (actin filaments) and cytoskeleton (cytokinetic bridge).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCIF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSI PGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCIF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
PCIF1 Protein (NBP2-13740PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCIF1 Antibody

  • bA465L10.1
  • C20orf67
  • chromosome 20 open reading frame 67
  • PDX-1 C terminus-interacting factor 1
  • PDX1 C-terminal inhibiting factor 1
  • phosphorylated CTD-interacting factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51077
Species: Hu
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7670
Species: Hu
Applications: WB, ICC
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBL1-11392
Species: Hu
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
NBP2-13740
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PCIF1 Antibody (NBP2-13740) (0)

There are no publications for PCIF1 Antibody (NBP2-13740).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCIF1 Antibody (NBP2-13740) (0)

There are no reviews for PCIF1 Antibody (NBP2-13740). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCIF1 Antibody (NBP2-13740) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCIF1 Products

Bioinformatics Tool for PCIF1 Antibody (NBP2-13740)

Discover related pathways, diseases and genes to PCIF1 Antibody (NBP2-13740). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCIF1 Antibody (NBP2-13740)

Discover more about diseases related to PCIF1 Antibody (NBP2-13740).
 

Pathways for PCIF1 Antibody (NBP2-13740)

View related products by pathway.

PTMs for PCIF1 Antibody (NBP2-13740)

Learn more about PTMs related to PCIF1 Antibody (NBP2-13740).

Blogs on PCIF1

There are no specific blogs for PCIF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCIF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCIF1