![Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining in human fallopian tube and liver tissues using anti-PCIF1 antibody. Corresponding PCIF1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/PCIF1-Antibody-Immunohistochemistry-Paraffin-NBP2-13740-img0008.jpg "Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining in human fallopian tube and liver tissues using anti-PCIF1 antibody. Corresponding PCIF1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCIF1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Western-Blot-NBL1-11392-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-03456-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-03456-img0003.jpg)
-Immunohistochemistry-Paraffin-NBP2-03456-img0004.jpg)
-Protein-Array-NBP3-07348-img0001.jpg)
-Flow-Cytometry-NBP3-07348-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NBP3-07348-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PCIF1 Antibody (NBP2-13740)Discover more about diseases related to PCIF1 Antibody (NBP2-13740).
| Pathways for PCIF1 Antibody (NBP2-13740)View related products by pathway.
|
PTMs for PCIF1 Antibody (NBP2-13740)Learn more about PTMs related to PCIF1 Antibody (NBP2-13740).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PCIF1 |
![Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize2/PCIF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13740-img0009.jpg "Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize2/PCIF1-Antibody-Immunohistochemistry-Paraffin-NBP2-13740-img0006.jpg "Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize2/PCIF1-Antibody-Immunohistochemistry-Paraffin-NBP2-13740-img0007.jpg "Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human liver shows low expression as expected.")
![Western Blot PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX-1_AF2419_Western_Blot_5187.jpg)
![Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Immunocytochemistry_16575.jpg)
![Simple Western PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Simple_Western_16996.jpg)
-Western-Blot-H00060485-M02-img0012.jpg)
-Immunocytochemistry-Immunofluorescence-H00060485-M02-img0006.jpg)
-Immunoprecipitation-H00060485-M02-img0007.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")