PBX1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Analysis in human fallopian tube and liver tissues using NBP1-86151 antibody. Corresponding PBX1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-86151 (A) shows similar protein ...read more
Western Blot: PBX1 Antibody [NBP1-86151] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: PBX1 Antibody [NBP1-86151] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human endometrium shows moderate nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PBX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSP
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PBX1 Protein (NBP1-86151PEP)
Publications
Read Publication using NBP1-86151.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23444221)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PBX1 Antibody

  • DKFZp686B09108
  • Homeobox protein PBX1
  • Homeobox protein PRL
  • MGC126627
  • Pre-B cell leukemia transcription factor-1
  • pre-B-cell leukemia homeobox 1
  • pre-B-cell leukemia transcription factor 1
  • PRL

Background

PBX1 binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
291-G1
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: WB
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NB300-506
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC, WB

Publications for PBX1 Antibody (NBP1-86151)(1)

Reviews for PBX1 Antibody (NBP1-86151) (0)

There are no reviews for PBX1 Antibody (NBP1-86151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PBX1 Antibody (NBP1-86151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PBX1 Products

Bioinformatics Tool for PBX1 Antibody (NBP1-86151)

Discover related pathways, diseases and genes to PBX1 Antibody (NBP1-86151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PBX1 Antibody (NBP1-86151)

Discover more about diseases related to PBX1 Antibody (NBP1-86151).
 

Pathways for PBX1 Antibody (NBP1-86151)

View related products by pathway.

PTMs for PBX1 Antibody (NBP1-86151)

Learn more about PTMs related to PBX1 Antibody (NBP1-86151).

Blogs on PBX1

There are no specific blogs for PBX1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PBX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX1