PBX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Analysis in human fallopian tube and liver tissues using NBP1-86151 antibody. Corresponding PBX1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human endometrium, fallopian tube, liver and prostate using Anti-PBX1 antibody NBP1-86151 (A) shows similar protein distribution across tissues to independent antibody NBP1-85803 (B).

Immunocytochemistry/Immunofluorescence: PBX1 Antibody [NBP1-86151] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human endometrium shows moderate nuclear positivity in stromal cells.

Immunohistochemistry-Paraffin: PBX1 Antibody [NBP1-86151] - Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Analysis in human cell line NTERA-2.

ChIP-Exo-Seq composite graph for Anti-PBX1 (NBP1-86151) tested in MCF7 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PBX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PBX1 Antibody - BSA Free (NBP1-86151) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PBX1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSP
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PBX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PBX1 Protein (NBP1-86151PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23444221)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PBX1 Antibody - BSA Free

• DKFZp686B09108
• Homeobox protein PBX1
• Homeobox protein PRL
• MGC126627
• Pre-B cell leukemia transcription factor-1
• pre-B-cell leukemia homeobox 1
• pre-B-cell leukemia transcription factor 1
• PRL

Background

PBX1 binds the sequence 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. Converted into a potent transcriptional activator by the (1;19) translocation. May have a role in steroidogenesis and, subsequently, sexual development a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PBX1 Antibody (NBP1-86151)(1)

Publication using NBP1-86151

• Petrini I, Wang Y, Zucali PA et al. Copy number aberrations of genes regulating normal thymus development in thymic epithelial tumors. Clin Cancer Res 2013-04-15 [PMID: 23444221]

Bioinformatics

• Gene Symbol: PBX1