PATZ Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PATZ Antibody [NBP2-48884] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry: PATZ Antibody [NBP2-48884] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PATZ Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PATZ1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PATZ Recombinant Protein Antigen (NBP2-48884PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PATZ Antibody - BSA Free

• dJ400N23
• MAZRPOZ-, AT hook-, and zinc finger-containing protein 1
• PATZZinc finger and BTB domain-containing protein 19
• POZ (BTB) and AT hook containing zinc finger 1
• Protein kinase A RI subunit alpha-associated protein
• RIAZBTB/POZ domain zinc finger transcription factor
• ZBTB19BTB-POZ domain zinc finger transcription factor
• Zinc finger protein 278Zinc finger sarcoma gene protein
• ZNF278POZ-AT hook-zinc finger protein
• ZSGMAZ-related factor

Background

PATZ is encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PATZ1