Parvalbumin Antibody - BSA Free

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same tissues.

Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebellum shows strong positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebral cortex shows strong positivity in a small subset of neurons.

Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human kidney shows strong positivity in cells in distal tubules.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Parvalbumin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Parvalbumin Antibody - BSA Free (NBP2-33529) is a polyclonal antibody validated for use in IHC and WB. Anti-Parvalbumin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PVALB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Parvalbumin Protein (NBP2-33529PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28835932). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Parvalbumin Antibody - BSA Free

• D22S749
• MGC116759
• parvalbumin alpha
• parvalbumin
• PV

Background

Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Parvalbumin Antibody (NBP2-33529)(1)

Publication using NBP2-33529

• Banasr M, Lepack A, Fee C et al. Characterization of GABAergic marker expression in the chronic unpredictable stress model of depression Chronic Stress (Thousand Oaks) 2017-02-01 [PMID: 28835932] (WB, Rat)

FAQs for Parvalbumin Antibody (NBP2-33529). (Showing 1 - 1 of 1 FAQ).

1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
   • We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.

Bioinformatics

• Gene Symbol: PVALB
• Uniprot:
  • P20472()