Orthogonal Strategies: Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Analysis in human parathyroid gland and liver tissues. Corresponding Parvalbumin RNA-seq data are presented for the same ...read more
Western Blot: Parvalbumin Antibody [NBP2-33529] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebellum shows strong positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human cerebral cortex shows strong positivity in a small subset of neurons.
Immunohistochemistry-Paraffin: Parvalbumin Antibody [NBP2-33529] - Staining of human kidney shows strong positivity in cells in distal tubules.
This antibody was developed against a recombinant protein corresponding to amino acids: ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PVALB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Rat reactivity reported in scientific literature (PMID: 28835932). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Parvalbumin Antibody - BSA Free
D22S749
MGC116759
parvalbumin alpha
parvalbumin
PV
Background
Parvalbumin is encoded by this gene is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. The encoded protein is thought to be involved in muscle relaxation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Parvalbumin Antibody (NBP2-33529). (Showing 1 - 1 of 1 FAQ).
I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Parvalbumin Antibody - BSA Free and receive a gift card or discount.