PARPBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PARPBP Antibody [NBP1-93969] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PARPBP Antibody [NBP1-93969] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARPBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
Specificity
Specificity of human C12orf48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARPBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PARPBP Recombinant Protein Antigen (NBP1-93969PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARPBP Antibody

  • AROM
  • C12orf48
  • chromosome 12 open reading frame 48
  • PARI
  • PARP1 binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-33485
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-23368
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00002984-M09
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for PARPBP Antibody (NBP1-93969) (0)

There are no publications for PARPBP Antibody (NBP1-93969).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARPBP Antibody (NBP1-93969) (0)

There are no reviews for PARPBP Antibody (NBP1-93969). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PARPBP Antibody (NBP1-93969) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PARPBP Products

Bioinformatics Tool for PARPBP Antibody (NBP1-93969)

Discover related pathways, diseases and genes to PARPBP Antibody (NBP1-93969). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARPBP Antibody (NBP1-93969)

Discover more about diseases related to PARPBP Antibody (NBP1-93969).

Blogs on PARPBP

There are no specific blogs for PARPBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARPBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARPBP