PARG Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PARG Antibody [NBP2-55661] - Staining of human cell line MCF7 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PARG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PARG Antibody - BSA Free (NBP2-55661) is a polyclonal antibody validated for use in ICC/IF. Anti-PARG Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PARG Recombinant Protein Antigen (NBP2-55661PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PARG Antibody - BSA Free

• EC 3.2.1.143
• FLJ54459
• FLJ60257
• FLJ60456
• PARG
• PARG99
• poly (ADP-ribose) glycohydrolase
• poly(ADP-ribose) glycohydrolase 60 kDa isoform
• poly(ADP-ribose) glycohydrolase

Background

Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARG Antibody (NBP2-55661)(1)

Publication using NBP2-55661

• Nie, L;Wang, C;Liu, X;Huang, M;Feng, X;Tang, M;Li, S;Hang, Q;Teng, H;Shen, X;Ma, L;Gan, B;Chen, J; DePARylation is critical for S phase progression and cell survival bioRxiv : the preprint server for biology 2023-08-02 [PMID: 37577639]

Bioinformatics

• Gene Symbol: PARG