ADPRHL2 Antibody

Images

 
Western Blot: ADPRHL2 Antibody [NBP1-88835] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ADPRHL2 Antibody [NBP1-88835] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: ADPRHL2 Antibody [NBP1-88835] - Staining of breast carcinoma, nuclear and cytoplasmic staining. Image from verified customer review.
Genetic Strategies: Western Blot: ADPRHL2 Antibody [NBP1-88835] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: ADPRHL2 Antibody [NBP1-88835] - Staining of human thyroid gland shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ADPRHL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
Specificity
Specificity of human ADPRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADPRHL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Immunohistochemistry verified by a customer review.
Control Peptide
ADPRHL2 Protein (NBP1-88835PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88835 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADPRHL2 Antibody

  • [Protein ADP-ribosylarginine] hydrolase-like protein 2
  • ADP-ribosylhydrolase 3
  • ADP-ribosylhydrolase like 2
  • ARH3EC 3.2.1.143
  • FLJ20446
  • poly(ADP-ribose) glycohydrolase ARH3
  • protein ADP-ribosylarginine hydrolase-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46320
Species: Hu
Applications: WB, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-39073
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83131
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20497
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57960
Species: Hu
Applications: ICC/IF
AF8355
Species: Hu
Applications: WB, IHC

Publications for ADPRHL2 Antibody (NBP1-88835) (0)

There are no publications for ADPRHL2 Antibody (NBP1-88835).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ADPRHL2 Antibody (NBP1-88835) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-88835:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry ADPRHL2 NBP1-88835
Enlarge
4
reviewed by:
Anony- mous
IHC Human 04/21/2014
View

Summary

ApplicationImmunohistochemistry
SpeciesHuman
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADPRHL2 Antibody (NBP1-88835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADPRHL2 Products

Bioinformatics Tool for ADPRHL2 Antibody (NBP1-88835)

Discover related pathways, diseases and genes to ADPRHL2 Antibody (NBP1-88835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADPRHL2 Antibody (NBP1-88835)

Discover more about diseases related to ADPRHL2 Antibody (NBP1-88835).
 

Pathways for ADPRHL2 Antibody (NBP1-88835)

View related products by pathway.

PTMs for ADPRHL2 Antibody (NBP1-88835)

Learn more about PTMs related to ADPRHL2 Antibody (NBP1-88835).

Blogs on ADPRHL2

There are no specific blogs for ADPRHL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anony- mous
04/21/2014
Application: IHC
Species: Human

Bioinformatics

Gene Symbol ADPRHL2