PARG Antibody (2B7M9)

Western Blot: PARG Antibody (2B7M9) [NBP3-33480] - Western blot analysis of lysates from PC-3 cells, using PARG Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 2B7M9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PARG Antibody (2B7M9) Summary

• Description: Novus Biologicals Rabbit PARG Antibody (2B7M9) (NBP3-33480) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant Protein corresponding to a sequence within amino acids 777-976 of human PARG.2).
  
  Sequence:
  HNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PARG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 111 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PARG Antibody (2B7M9)

• EC 3.2.1.143
• FLJ54459
• FLJ60257
• FLJ60456
• PARG
• PARG99
• poly (ADP-ribose) glycohydrolase
• poly(ADP-ribose) glycohydrolase 60 kDa isoform
• poly(ADP-ribose) glycohydrolase

Background

Poly(ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly(ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARG