Pappalysin-1/PAPP-A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Pappalysin-1/PAPP-A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAPPA.
  
  

  Source: E. coli

  Amino Acid Sequence: SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PAPPA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90087.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pappalysin-1/PAPP-A Recombinant Protein Antigen

• ASBABP2
• DIPLA1
• EC 3.4.24.79
• IGFBP-4ase
• IGFBP-4aseaspecific BCL2 ARE-binding protein 2
• IGF-dependent IGFBP-4 protease
• insulin-like growth factor-dependent IGF binding protein-4 protease
• Insulin-like growth factor-dependent IGF-binding protein 4 protease
• PAPA
• PAPPA
• PAPPA1
• PAPP-A1
• PAPP-Adifferentially placenta 1 expressed protein
• Pappalysin1
• Pappalysin-1
• pregnacy-associated plasma protein A
• Pregnancy-associated plasma protein A
• pregnancy-associated plasma protein A, pappalysin 1

Background

PAPP A was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500 kDa, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Reduced level of PAPP A in pregnancy blood in the first trimester is associated with fetal Down syndrome. PAPP A is considered as one of the best biochemical markers in early pregnancy used to screen for Down syndrome during the first trimester (Wald, N. J. et al).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP). (Showing 1 - 1 of 1 FAQ).

1. I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
   • Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.

Bioinformatics

• Gene Symbol: PAPPA