Pappalysin-1/PAPP-A Recombinant Protein Antigen

Images

 
There are currently no images for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pappalysin-1/PAPP-A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAPPA.

Source: E. coli

Amino Acid Sequence: SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAPPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90087.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pappalysin-1/PAPP-A Recombinant Protein Antigen

  • ASBABP2
  • DIPLA1
  • EC 3.4.24.79
  • IGFBP-4ase
  • IGFBP-4aseaspecific BCL2 ARE-binding protein 2
  • IGF-dependent IGFBP-4 protease
  • insulin-like growth factor-dependent IGF binding protein-4 protease
  • Insulin-like growth factor-dependent IGF-binding protein 4 protease
  • PAPA
  • PAPPA
  • PAPPA1
  • PAPP-A1
  • PAPP-Adifferentially placenta 1 expressed protein
  • Pappalysin1
  • Pappalysin-1
  • pregnacy-associated plasma protein A
  • Pregnancy-associated plasma protein A
  • pregnancy-associated plasma protein A, pappalysin 1

Background

PAPP A was originally isolated from pregnancy serum as heterotetrameric protein complex with molecular weight approximately 500 kDa, consisting of two PAPP A subunits disulfide-linked with two subunits of the proform of eosinophil major basic protein (proMBP). In such a complex proMBP functions as an inhibitor of PAPP A proteinase activity. PAPP A is widely used as a marker of some pathologies during pregnancy. Reduced level of PAPP A in pregnancy blood in the first trimester is associated with fetal Down syndrome. PAPP A is considered as one of the best biochemical markers in early pregnancy used to screen for Down syndrome during the first trimester (Wald, N. J. et al).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF804
Species: Hu
Applications: IHC, Neut, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
291-G1
Species: Hu
Applications: BA
NBP1-83910
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
AF1235
Species: Hu
Applications: IHC, WB
DY1707
Species: Hu
Applications: ELISA
292-G2
Species: Hu
Applications: BA
DPG00
Species: Hu
Applications: ELISA
NBP2-53210
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF578
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16019
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90087PEP
Species: Hu
Applications: AC

Publications for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP) (0)

There are no publications for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP) (0)

There are no reviews for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am highly interested to use couple of Anti-PAPP-A antibodies from your reputed companies for my research work. I have got the information regarding the immunogen used to generate these antibodies, however could not get any information regarding the specific amino acids/epitope to which your Anti-PAPP-A Antibodies binds with the antigen (PAPP-A).
    • Unfortunately, none of our PAPP A antibodies have been epitope mapped. Many of them have also been generated against full-length PAPP A, so there are many potential binding sites.

Additional Pappalysin-1/PAPP-A Products

Research Areas for Pappalysin-1/PAPP-A Protein (NBP1-90087PEP)

Find related products by research area.

Blogs on Pappalysin-1/PAPP-A

There are no specific blogs for Pappalysin-1/PAPP-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pappalysin-1/PAPP-A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAPPA