Pannexin-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Pannexin-2 Antibody [NBP1-92242] - Staining of human rectum shows low expression as expected.

Immunohistochemistry-Paraffin: Pannexin-2 Antibody [NBP1-92242] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Pannexin-2 Antibody [NBP1-92242] - Staining in human cerebral cortex and rectum tissues using anti-PANX2 antibody. Corresponding PANX2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pannexin-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pannexin-2 Antibody - BSA Free (NBP1-92242) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PANX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Pannexin-2 Protein (NBP1-92242PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Pannexin-2 Antibody - BSA Free

• hPANX2
• MGC119432
• pannexin 2
• Pannexin2
• Pannexin-2
• PANX2
• PX2

Background

The protein encoded by the Pannexin 2 gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PANX2