GJC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GJC3 Antibody [NBP1-88040] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: GJC3 Antibody [NBP1-88040] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GJC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GJC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GJC3 Protein (NBP1-88040PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GJC3 Antibody

  • connexin 29
  • connexin-30.2
  • Connexin-31.3
  • CX29
  • Cx30.2
  • CX30.2connexin-31.3
  • CX31.3
  • Gap junction epsilon-1 protein
  • gap junction gamma-3 protein
  • gap junction protein, epsilon 1, 29kDa
  • gap junction protein, gamma 3, 30.2kDa
  • GJE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-59263
Species: Hu
Applications: WB, IHC
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59160
Species: Hu
Applications: WB
NBP2-55398
Species: Hu
Applications: WB, ICC/IF
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-58660
Species: Hu
Applications: IHC-P
AF196
Species: Mu
Applications: WB, IHC
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS

Publications for GJC3 Antibody (NBP1-88040) (0)

There are no publications for GJC3 Antibody (NBP1-88040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GJC3 Antibody (NBP1-88040) (0)

There are no reviews for GJC3 Antibody (NBP1-88040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GJC3 Antibody (NBP1-88040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GJC3 Products

Bioinformatics Tool for GJC3 Antibody (NBP1-88040)

Discover related pathways, diseases and genes to GJC3 Antibody (NBP1-88040). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GJC3 Antibody (NBP1-88040)

Discover more about diseases related to GJC3 Antibody (NBP1-88040).
 

Pathways for GJC3 Antibody (NBP1-88040)

View related products by pathway.

Blogs on GJC3

There are no specific blogs for GJC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GJC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GJC3