PAG1 Antibody

Images

 
Western Blot: PAG1 Antibody [NBP2-56541] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PAG1 Antibody [NBP2-56541] - Staining of human cell line RT4 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PAG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKA
Specificity
Specificity of human PAG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PAG1 Recombinant Protein Antigen (NBP2-56541PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PAG1 Antibody

  • CBP
  • CBPMGC138364
  • Csk-binding protein
  • PAG1
  • PAGFLJ37858
  • phosphoprotein associated with glycosphingolipid microdomains 1
  • phosphoprotein associated with glycosphingolipid-enriched microdomains 1
  • Transmembrane adapter protein PAG
  • Transmembrane phosphoprotein Cbp

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NB200-310
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2695
Species: Hu
Applications: WB
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PAG1 Antibody (NBP2-56541) (0)

There are no publications for PAG1 Antibody (NBP2-56541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAG1 Antibody (NBP2-56541) (0)

There are no reviews for PAG1 Antibody (NBP2-56541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PAG1 Antibody (NBP2-56541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PAG1 Products

Bioinformatics Tool for PAG1 Antibody (NBP2-56541)

Discover related pathways, diseases and genes to PAG1 Antibody (NBP2-56541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAG1 Antibody (NBP2-56541)

Discover more about diseases related to PAG1 Antibody (NBP2-56541).
 

Pathways for PAG1 Antibody (NBP2-56541)

View related products by pathway.

PTMs for PAG1 Antibody (NBP2-56541)

Learn more about PTMs related to PAG1 Antibody (NBP2-56541).
 

Research Areas for PAG1 Antibody (NBP2-56541)

Find related products by research area.

Blogs on PAG1

There are no specific blogs for PAG1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PAG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAG1