PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free

Images

 
Genetic Strategies: Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody [NBP3-03887] - Analysis of extracts from normal (control) and PSME3 knockout (KO) 293T cells, using PA28 Activator gamma Subunit/PSME3 ...read more
Immunohistochemistry: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [PA28 Activator gamma Subunit/PSME3] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using PA28 Activator gamma ...read more
Immunocytochemistry/ Immunofluorescence: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [PA28 Activator gamma Subunit/PSME3] - Immunofluorescence analysis of NIH-3T3 cells using PA28 Activator gamma ...read more
Immunohistochemistry: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [PA28 Activator gamma Subunit/PSME3] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using PA28 Activator gamma ...read more
Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [PA28 Activator gamma Subunit/PSME3] - Western blot analysis of various lysates using PA28 Activator gamma Subunit/PSME3 Rabbit pAb at ...read more
Immunohistochemistry: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [PA28 Activator gamma Subunit/PSME3] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using PA28 Activator ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free
Validated by:
     

Genetic Strategies

   

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-254 of human PA28 Activator gamma Subunit/PSME3 (NP_005780.2). EDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSME3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Knockout Validated
  • Western Blot 1:1000 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free

  • 11S regulator complex gamma subunit
  • 11S regulator complex subunit gamma
  • Activator of multicatalytic protease subunit 3
  • Ki antigen
  • Ki
  • PA28 Activator gamma Subunit
  • PA28g
  • PA28gamma
  • PA28-gamma
  • PA28GKi nuclear autoantigen
  • proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
  • Proteasome activator 28 subunit gamma
  • proteasome activator 28-gamma
  • proteasome activator complex subunit 3
  • PSME3
  • REG gamma
  • REG-GAMMA

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83121
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP3-32868
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF1657
Species: Mu
Applications: WB
485-MI
Species: Mu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
H00005696-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-68858
Species: Hu
Applications: IHC,  IHC-P
NBP1-88660
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887) (0)

There are no publications for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887) (0)

There are no reviews for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA28 Activator gamma Subunit/PSME3 Products

Research Areas for PA28 Activator gamma Subunit/PSME3 Antibody (NBP3-03887)

Find related products by research area.

Blogs on PA28 Activator gamma Subunit/PSME3

There are no specific blogs for PA28 Activator gamma Subunit/PSME3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PSME3