PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free

Western Blot: PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free [NBP2-93183] - Western blot analysis of various lysates using PA28 Activator gamma Subunit/PSME3 Rabbit pAb at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP2-93183] - Immunohistochemistry of paraffin-embedded rat kidney using PA28 Activator gamma Subunit/PSME3 Rabbit pAb (NBP2-93183) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP2-93183] - Immunohistochemistry of paraffin-embedded human breast cancer using PA28 Activator gamma Subunit/PSME3 Rabbit pAb (NBP2-93183) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PA28 Activator gamma Subunit/PSME3 Antibody [NBP2-93183] - Immunohistochemistry of paraffin-embedded mouse lung using PA28 Activator gamma Subunit/PSME3 Rabbit pAb (NBP2-93183) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-254 of human PA28 Activator gamma Subunit/PSME3 (NP_005780.2). EDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSME3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PA28 Activator gamma Subunit/PSME3 Antibody - Azide and BSA Free

• 11S regulator complex gamma subunit
• 11S regulator complex subunit gamma
• Activator of multicatalytic protease subunit 3
• Ki antigen
• Ki
• PA28 Activator gamma Subunit
• PA28g
• PA28gamma
• PA28-gamma
• PA28GKi nuclear autoantigen
• proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
• Proteasome activator 28 subunit gamma
• proteasome activator 28-gamma
• proteasome activator complex subunit 3
• PSME3
• REG gamma
• REG-GAMMA

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Two transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PSME3