Recombinant Human p63/TP73L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human p63/TP73L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human TP63 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TP63

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p63/TP73L Protein

  • amplified in squamous cell carcinoma
  • Chronic ulcerative stomatitis protein
  • CUSP
  • EEC3
  • EEC3B(p51B)
  • Keratinocyte transcription factor KET
  • KET
  • KETRHS
  • LMS
  • OFC8
  • OFC8SHFM4TP73LNBP
  • p40
  • p51
  • p51tumor protein p53-like
  • p53CP
  • p63
  • p63AIS
  • p73H
  • p73L
  • p73LB(p51A)
  • SHFM4
  • TP53CP
  • TP53L
  • TP63
  • TP73L
  • Transformation-related protein 63
  • tumor protein 63
  • tumor protein p53-competing protein
  • tumor protein p63 deltaN isoform delta
  • tumor protein p63
  • Tumor protein p73-like

Background

TP73L - tumor protein p73-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF7250
Species: Hu
Applications: IHC
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF2428
Species: Hu
Applications: WB
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for p63/TP73L Partial Recombinant Protein (H00008626-Q01) (0)

There are no publications for p63/TP73L Partial Recombinant Protein (H00008626-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p63/TP73L Partial Recombinant Protein (H00008626-Q01) (0)

There are no reviews for p63/TP73L Partial Recombinant Protein (H00008626-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p63/TP73L Partial Recombinant Protein (H00008626-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p63/TP73L Products

p63/TP73L H00008626-Q01

Bioinformatics Tool for p63/TP73L Partial Recombinant Protein (H00008626-Q01)

Discover related pathways, diseases and genes to p63/TP73L Partial Recombinant Protein (H00008626-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p63/TP73L Partial Recombinant Protein (H00008626-Q01)

Discover more about diseases related to p63/TP73L Partial Recombinant Protein (H00008626-Q01).
 

Pathways for p63/TP73L Partial Recombinant Protein (H00008626-Q01)

View related products by pathway.

PTMs for p63/TP73L Partial Recombinant Protein (H00008626-Q01)

Learn more about PTMs related to p63/TP73L Partial Recombinant Protein (H00008626-Q01).
 

Research Areas for p63/TP73L Partial Recombinant Protein (H00008626-Q01)

Find related products by research area.

Blogs on p63/TP73L

There are no specific blogs for p63/TP73L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p63/TP73L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TP63
Entrez