p53 DINP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: p53 DINP1 Antibody [NBP1-85108] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.

Immunohistochemistry-Paraffin: p53 DINP1 Antibody [NBP1-85108] - Staining of human cerebral cortex shows nuclear positivity in both neuronal and glial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p53 DINP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit p53 DINP1 Antibody - BSA Free (NBP1-85108) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TP53INP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p53 DINP1 Protein (NBP1-85108PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p53 DINP1 Antibody - BSA Free

• DKFZp434M1317
• FLJ22139
• p53DINP1
• P53DINP1p53-dependent damage-inducible nuclear protein 1
• p53-inducible p53DINP1
• SIPStress-induced protein
• Teap
• TP53DINP1
• TP53INP1A
• TP53INP1B
• tumor protein p53 inducible nuclear protein 1
• tumor protein p53-inducible nuclear protein 1

Background

Apoptosis is related to many diseases and development. The p53 tumor-suppressor protein induces apoptosis through transcriptional activation of several genes. A novel p53 inducible gene was identified recently and designated p53DINP1 (for p53-dependent damage-inducible nuclear protein and SIP (for stress induced protein) in human and mouse. A p53DINP1 antisense oligonucleotide inhibits and overexpression of p53DINP1 enhances Ser46 phosphorylation of p53, induction of p53AIP1, and cell death induced by DNA double-strand breaks. p53DINP1 may regulate p53-dependent apoptosis through phosphorylation at Ser46 and induction of p53AIP1. The p53DINP1/SIP gene encodes two proteins of 27 and 18 kDa in human and mouse termed p53DINP1-a and p53DINP1-b or SIP27 and SIP18. p53DINP1/SIP is expressed in many tissues and induced by a variety of stress agents including UV stress, mutagenic stress, heat shock, and oxidative stress.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TP53INP1