p53 DINP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: p53 DINP1 Antibody [NBP1-85108] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
Immunohistochemistry: p53 DINP1 Antibody [NBP1-85108] - Staining of human cerebral cortex shows nuclear positivity in both neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p53 DINP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TP53INP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
p53 DINP1 Protein (NBP1-85108PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p53 DINP1 Antibody

  • DKFZp434M1317
  • FLJ22139
  • p53DINP1
  • P53DINP1p53-dependent damage-inducible nuclear protein 1
  • p53-inducible p53DINP1
  • SIPStress-induced protein
  • Teap
  • TP53DINP1
  • TP53INP1A
  • TP53INP1B
  • tumor protein p53 inducible nuclear protein 1
  • tumor protein p53-inducible nuclear protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98280
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1436
Species: Mu
Applications: WB

Publications for p53 DINP1 Antibody (NBP1-85108) (0)

There are no publications for p53 DINP1 Antibody (NBP1-85108).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p53 DINP1 Antibody (NBP1-85108) (0)

There are no reviews for p53 DINP1 Antibody (NBP1-85108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for p53 DINP1 Antibody (NBP1-85108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p53 DINP1 Products

Bioinformatics Tool for p53 DINP1 Antibody (NBP1-85108)

Discover related pathways, diseases and genes to p53 DINP1 Antibody (NBP1-85108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p53 DINP1 Antibody (NBP1-85108)

Discover more about diseases related to p53 DINP1 Antibody (NBP1-85108).
 

Pathways for p53 DINP1 Antibody (NBP1-85108)

View related products by pathway.

PTMs for p53 DINP1 Antibody (NBP1-85108)

Learn more about PTMs related to p53 DINP1 Antibody (NBP1-85108).
 

Research Areas for p53 DINP1 Antibody (NBP1-85108)

Find related products by research area.

Blogs on p53 DINP1

There are no specific blogs for p53 DINP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p53 DINP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53INP1