P2Y12/P2RY12 Antibody - BSA Free

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining in human cerebral cortex and liver tissues . Corresponding P2RY12 RNA-seq data are presented for the same tissues.

Western Blot: P2Y12/P2RY12 Antibody [NBP2-33870] - Quantitative biochemical measurements of P2Y12/P2RY12 protein and mRNA in human brains. Western blot measurements of P2Y12/P2RY12 levels in MTG samples from LP, HP and AD brains. Representative western blot image of P2Y12/P2RY12 polypeptide of MTG protein extracts identified with Novus antibody. Blots were normalized for levels of beta actin. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: P2Y12/P2RY12 Antibody [NBP2-33870] - Green-P2Y12/P2RY12, Blue-DAPI. 1:200 dilution for fixed tissue sections of feline optical nerve. ICC/IF image submitted by a verified customer review.

Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Features of P2Y12/P2RY12-immunoreactive microglia. (I,J). Staining of representative sections with P2Y12/P2RY12 (Novus) antibody preabsorbed with immunizing peptide (I, +Pep) compared to staining of matched section with P2Y12/P2RY12 antibody non-absorbed (J, -Pep). (K,L). Staining of matched sections with alternative P2Y12/P2RY12 antibody. Same staining pattern of microglia revealed with P2Y12/P2RY12 (Novus) antibody (C) as with P2Y12/P2RY12 (Alomone Labs) antibody. All sections shown had been counterstained with neutral red to identify nuclei (red color). Abbreviations: ND: non-demented. AD: Alzheimer's disease. MTG: middle temporal gyrus.-Pep: antibody without immunizing peptide. + Pep: antibody with immunizing peptide. Scale bars represent 50 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/21/2/678), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human liver shows no positivity as expected.

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: P2Y12/P2RY12 Antibody [NBP2-33870] - Staining of human cerebellum shows strong cytoplasmic positivity in microglia.

Immunohistochemistry-Frozen: P2Y12/P2RY12 Antibody [NBP2-33870] - Canine optic nerve. Immunofluorescent signal was detected using Alexa Fluor 488 conjugated secondary antibody (green). IHC-Fr image submitted by a verified customer review.

Immunohistochemistry: P2Y12/P2RY12 Antibody [NBP2-33870] - Images demonstrating colocalization of CD105/MAB1097 with microglial markers (a) panels A, B Low magnification images of high-plaque (HP) case (panel A) & AD case (panel B) showing staining with CD105/MAB1097 (purple arrows) & IBA-1 (brown arrows) in MTG sections. Both images at same magnification: scale bars represent 100 μm. (b) (panel A) CD105 microglia (purple arrows) with ramified morphology stained with antibody to P2RY12 (brown arrow) in low-plaque (LP) case. (panel B) CD105 microglia (purple arrows) & HLA-DR (brown arrow) in AD case. (panel C) CD105 microglia (purple arrow) & CD45 (brown arrow) in AD case. All sections were from MTG. Images at same magnification: scale bars represent 50 μm. (c) (panel A–E). Patterns of staining of CD105 (purple) & IBA-1 (brown) in MTG sections of cases with progressively increasing pathology from LP to AD. (panel F). CD105-positive microglia in hippocampus (HPC) of AD case. Images at same magnification: scale bars represent 50 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31340569), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Ca, Fe
• Applications: WB, ICC/IF, IHC, mIF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P2Y12/P2RY12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence validated from a verified customer review
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen Validated from a verified customer review
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Multiplex Immunofluorescence
  • Western Blot reported in scientific literature (PMID:31968618).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  P2Y12/P2RY12 Protein (NBP2-33870PEP)

Reactivity Notes

Feline, Canine reactivity reported from verified customer reviews.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for P2Y12/P2RY12 Antibody - BSA Free

• ADPG-R
• Gi-coupled ADP receptor HORK3
• HORK3
• HORK3P2Y12 platelet ADP receptor
• P2RY12
• P2T(AC)
• P2Y purinoceptor 12
• P2Y(AC)
• P2Y(ADP)
• P2Y(cyc)
• P2Y12
• P2Y12ADP-glucose receptor
• purinergic receptor P2RY12
• purinergic receptor P2Y, G-protein coupled, 12
• putative G-protein coupled receptor
• SP1999
• SP1999G-protein coupled receptor SP1999

Background

P2Y12 is a Purinergic Receptor essential for the aggregation of blood platelets. There is evidence that mutations in P2Y12 cause a bleeding disorder, suggesting that knowledge of the P2Y12 receptor could advance the development of antiplatelet agents to treat cardiovascular diseases. Expression of P2Y12 has been reported in platelets, spinal cord, and many brain regions. ESTs for P2Y12 have been isolated from B-cell/lung/testis, brain, embryo, prostate, eye, kidney carcinoma, and colon carcinoma libraries. Cognate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P2Y12/P2RY12 Antibody (NBP2-33870)(14)

Publications using NBP2-33870

• Li C, Liu K, Zhu J, Zhu F The effects of high plasma levels of A beta 1-42 on mononuclear macrophage in mouse models of Alzheimer's disease Research Square 2022-12-07 (IHC, Mouse)
• Yokoyama T, Saino T, Nakamuta N, Yamamoto Y. et Al. Immunohistochemical localization of P2Y12 purinoceptors in the rat carotid body Auton Neurosci 2024-02-29 [PMID: 38422662]
• Maesawa S, Yokoyama T, Sakanoue W, Yamamoto Y et Al. ADP-mediated Modulation of Intracellular Calcium Responses in Chromaffin Cells: The Role of Ectonucleoside Triphosphate Diphosphohydrolase 2 on Rat Adrenal Medulla Function J Histochem Cytochem 2023-12-30 [PMID: 38158780]
• Wang Y, Wang W, Su L, Ji F et Al. BACH1 changes microglial metabolism and affects astrogenesis during mouse brain development Dev Cell 2023-12-15 [PMID: 38101413]
• Zhou Y, Bhatt H, Mojica CA et al. Mesenchymal-derived extracellular vesicles enhance microglia-mediated synapse remodeling after cortical injury in aging Rhesus monkeys Journal of neuroinflammation 2023-09-02 [PMID: 37660145] (IHC, Monkey)
• Zhou Y, Bhatt H, Mojica C et al. Mesenchymal-Derived Extracellular Vesicles Enhance Microglia-mediated Synapse Remodeling after Cortical Injury in Rhesus Monkeys Research Square 2023-05-15 [PMID: 37292805] (IHC, Rhesus Macaque)
• Alban TJ, Grabowski MM, Otvos B et al. The MIF promoter SNP rs755622 is associated with immune activation in glioblastoma JCI insight 2023-07-10 [PMID: 37252795] (Immunohistochemistry, Human)
  
  Details:
  1:50 IHC-P dilution
• Jean Paul Chadarevian; Sonia I. Lombroso; Graham C. Peet; Jonathan Hasselmann; Christina Tu; Dave E. Marzan et al. Engineering an inhibitor-resistant human CSF1R variant for microglia replacement Journal of Experimental Medicine 2023-03-06 [PMID: 36584406] (Immunohistochemistry, Human)
• Milior G, Morin-Brureau M, Chali F et al. Distinct P2Y receptors mediate extension and retraction of microglial processes in epileptic and peri-tumoral human tissue J. Neurosci. 2020-01-02 [PMID: 31896671] (IF/IHC, Human)
• Morin-Brureau M, Milior G, Royer J et al. Microglial phenotypes in the human epileptic temporal lobe. Brain. 2018-12-01 [PMID: 30462183] (IF/IHC, Human)
• Walker D, Tang T, Takeuchi S et al. Immunophenotyping of Microglia In Alzheimers Disease Brains: Comparison of Expression of Progranulin and Purinergic Receptor P2Ry12 Alzheimer's & Dementia 2018-07-01 (IF/IHC, Human)
• Walker DG, Lue LF, Beach TG, Tooyama I, Microglial Phenotyping in Neurodegenerative Disease Brains: Identification of Reactive Microglia with an Antibody to Variant of CD105/Endoglin Cells 2019-07-23 [PMID: 31340569] (IF/IHC, Human)

Reviews for P2Y12/P2RY12 Antibody (NBP2-33870) (3)

Average Rating: 3.3

(Based on 3 reviews)

We have 3 reviews tested in 3 species: Mouse, Canine, Feline.

reviewed by: Helena Morrison Immunohistochemistry-Fixed; cryoprotected Mouse 02/07/2020

Summary

• Application: Other
• Sample Tested: Mouse brain
• Species: Mouse
• Lot: 000002071

Comments

• Comments: Free floating coronal sections 50um. 72 hr primary @ RT with 4hr secondary @ RT. ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Verified Customer IHC-Fr Canine 08/07/2018

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Optic nerve
• Species: Canine
• Lot: E117072

reviewed by: Verified Customer ICC Feline 05/11/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: optic nerve
• Species: Feline
• Lot: B105407

Comments

• Comments: 1:200 dilution for fixed tissue sections.

Bioinformatics

• Gene Symbol: P2RY12