Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF |
Clone | 2A2-1A2 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | OXSR1 (AAH08726, 1 a.a. ~ 528 a.a) full length recombinant protein with GST tag.MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEK
VAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVV
KDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATI
LREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVS
AFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI
WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPP |
Specificity | OXSR1 - oxidative-stress responsive 1 |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | OXSR1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Diseases for OXSR1 Antibody (H00009943-M01)Discover more about diseases related to OXSR1 Antibody (H00009943-M01).
| Pathways for OXSR1 Antibody (H00009943-M01)View related products by pathway.
|
PTMs for OXSR1 Antibody (H00009943-M01)Learn more about PTMs related to OXSR1 Antibody (H00009943-M01).
| Research Areas for OXSR1 Antibody (H00009943-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.