Home » OXSR1 » OXSR1 Antibodies » OXSR1 Antibody (2A2-1A2)

OXSR1 Antibody (2A2-1A2)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: OXSR1 Antibody (2A2-1A2) [H00009943-M01] - OXSR1 monoclonal antibody (M01), clone 2A2-1A2 Analysis of OXSR1 expression in A-431.
Western Blot: OXSR1 Antibody (2A2-1A2) [H00009943-M01] - OXSR1 monoclonal antibody (M01), clone 2A2-1A2 Analysis of OXSR1 expression in A-431.
Immunocytochemistry/ Immunofluorescence: OXSR1 Antibody (2A2-1A2) [H00009943-M01] - Analysis of monoclonal antibody to OXSR1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: OXSR1 Antibody (2A2-1A2) [H00009943-M01] - Detection limit for recombinant GST tagged OXSR1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2A2-1A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

OXSR1 Antibody (2A2-1A2) Summary

Immunogen
OXSR1 (AAH08726, 1 a.a. ~ 528 a.a) full length recombinant protein with GST tag.MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEK VAIKRINLEKCQTSMDELLKEIQAMSQCHHPNIVSYYTSFVV KDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATI LREVLEGLEYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVS AFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPP
Specificity
OXSR1 - oxidative-stress responsive 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OXSR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publications using H00009943-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OXSR1 Antibody (2A2-1A2)

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1101OSR1serine/threonine-protein kinase OSR1
  • Oxidative stress-responsive 1 protein
  • oxidative-stress responsive 1

Background

The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

STK39 Antibody
(OTI4E3)
NBP1-48021
Western Blot: STK39 Antibody (4E3) [NBP1-48021] Analysis of extracts (35ug) from 9 different cell lines by usin g anti-STK39 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunocytochemistry/Immunofluorescence: STK39 Antibody (4E3) [NBP1-48021] - Immunofluorescent staining of COS7 cells using anti-STK39 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: STK39 Antibody (4E3) [NBP1-48021] - Staining of paraffin-embedded Human Ovary tissue using anti-STK39 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SLC12A3 Antibody
NBP1-86376
Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: SLC12A3 Antibody [NBP1-86376] - Staining in human kidney and lymph node tissues using anti-SLC12A3 antibody. Corresponding SLC12A3 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
WNK4 Antibody
NB600-284
Western Blot: WNK4 Antibody [NB600-284] - Western Blot Image of anti-WNK4. Whole cell protein from Hek293 was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-WNK4 in 1% milk and detected with an anti-rabbit HRP secondary antibody using chemiluminescence
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
WNK1 Antibody
NB600-225
Western Blot: WNK1 Antibody [NB600-225] - Detection of the short form of WNK1 in F-11 cell lysate.
Immunocytochemistry/Immunofluorescence: WNK1 Antibody [NB600-225] - WNK1 antibody was tested in HEK293 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NKCC1/SLC12A2
Antibody
NBP1-52148
Immunohistochemistry-Paraffin: NKCC1/SLC12A2 Antibody [NBP1-52148] - (3.8ug/ml) staining of paraffin embedded Human Colon. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MST3 Antibody
NBP1-87833
Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: MST3 Antibody [NBP1-87833] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NKCC2/SLC12A1
Antibody
NBP1-80993
Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining in human kidney and lymph node tissues using anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows high expression.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
OSR2 Antibody
NBP2-56333
Western Blot: OSR2 Antibody [NBP2-56333] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: OSR2 Antibody [NBP2-56333] - Staining of human cell line HEK 293 shows localization to plasma membrane.
Immunocytochemistry/Immunofluorescence: OSR2 Antibody [NBP2-56333] - Staining of human cell line A-431 shows localization to nucleus & plasma membrane.
Species: Hu
Applications: WB, ICC/IF
WNK3 Antibody
NBP2-57909
Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-57909] - Staining of human cell line SiHa shows localization to vesicles.
Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-57909] - Staining of human cell line U-2 OS shows localization to vesicles.
Species: Hu
Applications: ICC/IF
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(36 Publications)
Species: Hu
Applications: WB, IHC, IP
Pax2 Antibody (3C7)
H00005076-M01
Western Blot: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7.Lane 1: PAX2 transfected lysate(47.41 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Pax2 Antibody (3C7) [H00005076-M01] - Analysis of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 0.5 ug/ml.
ELISA: Pax2 Antibody (3C7) [H00005076-M01] - Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.
(6 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
WT1 Antibody
(6F-H2)
NB110-60011
Western Blot: WT1 Antibody (6F-H2) [NB110-60011] - Whole cell protein from human K562, Hek293 and kidney tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-WT1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: WT1 Antibody (6F-H2) [NB110-60011] - Human kidney tissue, staining of kidney glomerulus. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH 6) at 95C for 20 minutes. Image from verified customer review.
Immunohistochemistry: WT1 Antibody (6F-H2) [NB110-60011] - IHC analysis of Wilms Tumor 1 in human renal cancer using DAB with hematoxylin counterstain.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
Crk Antibody
(3G11E8)
NBP2-37568
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Crk Antibody (3G11E8) [NBP2-37568] - Immunofluorescence analysis of 3T3-L1 cells using CRK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Crk Antibody (3G11E8) [NBP2-37568] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues using CRK mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
p38 alpha Antibody
[Unconjugated]
AF8691
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and Recombinant Human Active p38 alpha (Catalog # 5477-KS) (2 ng/lane). PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Orexin B, p38 alpha, and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
RELT/TNFRSF19L
Antibody [Unconjugate
AF1385
Western blot shows lysates of human bone marrow tissue and human lymph node tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human RELT/TNFRSF19L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1385) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for RELT/TNFRSF19L at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] Analysis of extracts (35ug) from 9 different cell lines by using anti-GRAP2 monoclonal antibody.
Immunohistochemistry-Paraffin: GRAP2 Antibody (1G2) [NBP2-00764] - Staining of paraffin-embedded Human endometrium tissue using anti-GRAP2 mouse monoclonal antibody.
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AIMP2 Antibody
NBP1-81575
Western Blot: AIMP2 Antibody [NBP1-81575] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: AIMP2 Antibody [NBP1-81575] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: AIMP2 Antibody [NBP1-81575] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SIX2 Antibody (3D7)
H00010736-M01
Western Blot: SIX2 Antibody (3D7) [H00010736-M01] - Analysis of SIX2 expression in transfected 293T cell line by SIX2 monoclonal antibody (M01), clone 3D7.Lane 1: SIX2 transfected lysate(32.3 KDa).Lane 2: Non-transfected lysate.
Western Blot: SIX2 Antibody (3D7) [H00010736-M01] - Analysis of SIX2 over-expressed 293 cell line, cotransfected with SIX2 Validated Chimera RNAi ( Cat # H00010736-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SIX2 monoclonal antibody (M01), clone 3D7 (Cat # H00010736-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
ELISA: SIX2 Antibody (3D7) [H00010736-M01] - Detection limit for recombinant GST tagged SIX2 is 0.03 ng/ml as a capture antibody.
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, RNAi, RNAi SP

Publications for OXSR1 Antibody (H00009943-M01)(2)


Reviews for OXSR1 Antibody (H00009943-M01) (0)

There are no reviews for OXSR1 Antibody (H00009943-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OXSR1 Antibody (H00009943-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OXSR1 Products

Bioinformatics Tool for OXSR1 Antibody (H00009943-M01)

Discover related pathways, diseases and genes to OXSR1 Antibody (H00009943-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OXSR1 Antibody (H00009943-M01)

Discover more about diseases related to OXSR1 Antibody (H00009943-M01).
 

Pathways for OXSR1 Antibody (H00009943-M01)

View related products by pathway.

PTMs for OXSR1 Antibody (H00009943-M01)

Learn more about PTMs related to OXSR1 Antibody (H00009943-M01).
 

Research Areas for OXSR1 Antibody (H00009943-M01)

Find related products by research area.

Blogs on OXSR1

There are no specific blogs for OXSR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OXSR1 Antibody (2A2-1A2) and receive a gift card or discount.


Bioinformatics

Gene Symbol OXSR1
Entrez
OMIM
Uniprot