OSR2 Antibody

Images

 
Western Blot: OSR2 Antibody [NBP2-56333] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: OSR2 Antibody [NBP2-56333] - Staining of human cell line HEK 293 shows localization to plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSR2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: THRSQELRGAAATEGFLYVLLSHWVFVGAPRPPASDSWKKGLVPSAPPASRKMGSKALPAPIPLHPSLQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OSR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OSR2 Recombinant Protein Antigen (NBP2-56333PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for OSR2 Antibody

  • odd-skipped related 2 (Drosophila)
  • protein odd-skipped-related 2

Background

OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 (PubMed15175245)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OSR2 Antibody (NBP2-56333) (0)

There are no publications for OSR2 Antibody (NBP2-56333).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSR2 Antibody (NBP2-56333) (0)

There are no reviews for OSR2 Antibody (NBP2-56333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OSR2 Antibody (NBP2-56333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OSR2 Products

Research Areas for OSR2 Antibody (NBP2-56333)

Find related products by research area.

Blogs on OSR2

There are no specific blogs for OSR2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OSR2