OXSM Antibody

Images

 
Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human lymph node.
Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human spleen shows strong cytoplasmic positivity in cells of white pulp.
Independent Antibodies: Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-OXSM antibody NBP1-84732 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human kidney.
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human testis.
Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

OXSM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OXSM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OXSM Protein (NBP1-84732PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OXSM Antibody

  • 3-ketoacyl-acyl carrier protein synthase
  • 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
  • 3-oxoacyl-ACP synthase, mitochondrial
  • acyl-malonyl acyl carrier protein-condensing enzyme
  • beta-ketoacyl synthase
  • Beta-ketoacyl-ACP synthase
  • EC 2.3.1
  • EC 2.3.1.41
  • FASN2D
  • FLJ20604
  • KASI
  • KS3-oxoacyl-acyl-carrier-protein synthase
  • type II mitochondrial beta-ketoacyl synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
D6050
Species: Hu
Applications: ELISA
NBP2-67843
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP1-86687
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33710
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DVE00
Species: Hu
Applications: ELISA
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84732
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for OXSM Antibody (NBP1-84732) (0)

There are no publications for OXSM Antibody (NBP1-84732).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXSM Antibody (NBP1-84732) (0)

There are no reviews for OXSM Antibody (NBP1-84732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OXSM Antibody (NBP1-84732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OXSM Products

Bioinformatics Tool for OXSM Antibody (NBP1-84732)

Discover related pathways, diseases and genes to OXSM Antibody (NBP1-84732). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OXSM

There are no specific blogs for OXSM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OXSM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OXSM