![Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize2/OXSM-Antibody-Western-Blot-NBP1-84732-img0006.jpg "Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PQSEADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OXSM |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-KCNQ1 Monoclonal Antibody at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.](http://images.novusbio.com/images2/Kv7.1-Antibody-(S37A-10)-Immunohistochemistry-NBP2-12897-img0009.jpg)
![Western Blot: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Western Blot analysis of Human Cell lysates showing detection of Kv7.1 protein using Mouse Anti-Kv7.1 Monoclonal Antibody, Clone N37A/10 (NBP2-12897). Load: 15 ug. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Kv7.1 Monoclonal Antibody (NBP2-12897) at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.](http://images.novusbio.com/images2/Kv7.1-Antibody-(S37A-10)-Western-Blot-NBP2-12897-img0010.jpg)
![Immunohistochemistry: Kv7.1 Antibody (S37A/10) [NBP2-12897] - Immunohistochemistry analysis using Mouse Anti-Kv7.1 Monoclonal Antibody, Clone N37A/10 (NBP2-12897). Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Kv7.1 Monoclonal Antibody (NBP2-12897) at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.](http://images.novusbio.com/images2/Kv7.1-Antibody-(S37A-10)-Immunohistochemistry-NBP2-12897-img0011.jpg)
![Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-Frozen-NBP1-19371-img0013.jpg)
![Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.](http://images.novusbio.com/images2/CD4-Antibody-Immunohistochemistry-Paraffin-NBP1-19371-img0014.jpg)
![Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.](http://images.novusbio.com/images2/CD4-Antibody-Flow-Cytometry-NBP1-19371-img0015.jpg)
![Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human breast cancer using Kv11.1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/Kv11.1-Antibody-Immunohistochemistry-Paraffin-NBP3-03109-img0001.jpg)
![Immunohistochemistry-Paraffin: Kv11.1 Antibody [NBP3-03109] - Paraffin-embedded human colon carcinoma using Kv11.1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/Kv11.1-Antibody-Immunohistochemistry-Paraffin-NBP3-03109-img0002.jpg)
![Western Blot: Kv11.1 Antibody [NBP3-03109] - Analysis of extracts of various cell lines, using Kv11.1 antibody at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhan](http://images.novusbio.com/images2/Kv11.1-Antibody-Western-Blot-NBP3-03109-img0004.jpg)
![Dual RNAscope ISH-IHC: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - FFPE tissue sections of human metastatic tonsil were probed for Pan Cytokeratin mRNA (ACD RNAScope probe, catalog # 310221; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processes for IHC using mouse monoclonal antibody (Novus catalog # NBP2-29429) at 0.3 ug/mL for 1 hour at room temperature followed by incubation with the anti-mouse IgG VisUCyte HRP Polymer Antibody (Novus Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).](http://images.novusbio.com/images2/Cytokeratin--pan-Antibody-(AE-1-AE-3)-Dual-RNAscope-ISH-IHC-NBP2-29429-img0015.jpg)
![CyTOF-reported: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human fibroblasts. Blue: fibroblasts. Red: fibroblast + cytokeratin transfection. CyTOF image submitted by a verified customer review.](http://images.novusbio.com/images2/Cytokeratin--pan-Antibody-(AE-1-AE-3)-CyTOF-reported-NBP2-29429-img0016.jpg)
![Flow Cytometry: Cytokeratin, pan Antibody (AE-1/AE-3) [NBP2-29429] - Human Pan-Cytokeratins on HeLa Cells. Black: Cells alone; Green: Isotype Control; Red: PE-labeled Pan-Cytokeratin Monoclonal Antibody (AE-1/AE-3)](http://images.novusbio.com/images2/Cytokeratin--pan-Antibody-(AE-1-AE-3)-Flow-Cytometry-NBP2-29429-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Immunocytochemistry-Immunofluorescence-NB400-114-img0012.jpg)
![Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Analysis of Fatty Acid Synthase, using NB400-114. Samples: 50 ug of total mouse liver lysate.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Western-Blot-NB400-114-img0007.jpg)
![Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.](http://images.novusbio.com/images2/Fatty-Acid-Synthase-FASN-Antibody-Immunohistochemistry-Paraffin-NB400-114-img0009.jpg)
![Flow Cytometry: A-RAF Antibody (JJ08-68) [NBP2-67843] - Analysis of Hela cells with A-RAF antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/A-RAF-Antibody-(JJ08-68)-Flow-Cytometry-NBP2-67843-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: A-RAF Antibody (JJ08-68) [NBP2-67843] - Staining A-RAF in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/A-RAF-Antibody-(JJ08-68)-Immunocytochemistry-Immunofluorescence-NBP2-67843-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: A-RAF Antibody (JJ08-68) [NBP2-67843] - Staining A-RAF in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/A-RAF-Antibody-(JJ08-68)-Immunocytochemistry-Immunofluorescence-NBP2-67843-img0003.jpg)
![Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in U2OS cell lysate.](http://images.novusbio.com/images2/Aggrecan-Neoepitope-Antibody-Western-Blot-NB100-74350-img0002.jpg)
![Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in L929 whole cell extract using NB100-74350.](http://images.novusbio.com/images2/Aggrecan-Neoepitope-Antibody-Western-Blot-NB100-74350-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Aggrecan Neoepitope Antibody [NB100-74350] - Detection of ACAN in OA cartilage using NB100-74350.](http://images.novusbio.com/images2/Aggrecan-Neoepitope-Antibody-Immunocytochemistry-Immunofluorescence-NB100-74350-img0007.jpg)
![Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/Peripherin-2-PRPH2-Antibody-Western-Blot-NBP1-86687-img0006.jpg)
![Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/images2/Peripherin-2-PRPH2-Antibody-Immunohistochemistry-Paraffin-NBP1-86687-img0007.jpg)
![Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/images2/Peripherin-2-PRPH2-Antibody-Immunohistochemistry-Paraffin-NBP1-86687-img0008.jpg)
![Immunohistochemistry-Paraffin: NDUFAB1 Antibody [NBP2-33710] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/images2/NDUFAB1-Antibody-Immunohistochemistry-Paraffin-NBP2-33710-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: NDUFAB1 Antibody [NBP2-33710] - Staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/images2/NDUFAB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33710-img0005.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OXSM |
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human lymph node.](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0010.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human lymph node.")
![Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/OXSM-Antibody-Western-Blot-NBP1-84732-img0005.jpg "Western Blot: OXSM Antibody [NBP1-84732] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human spleen shows strong cytoplasmic positivity in cells of white pulp.](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0002.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human spleen shows strong cytoplasmic positivity in cells of white pulp.")
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-OXSM antibody NBP1-84732 (A) shows similar protein distribution across tissues to independent antibody NBP1-84730 (B).](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0007.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-OXSM antibody NBP1-84732 (A) shows similar protein distribution across tissues to independent antibody NBP1-84730 (B).")
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human kidney.](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0008.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human testis.](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0009.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human testis.")
![Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/OXSM-Antibody-Immunohistochemistry-Paraffin-NBP1-84732-img0011.jpg "Immunohistochemistry-Paraffin: OXSM Antibody [NBP1-84732] - Staining of human cerebral cortex.")
![ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/images2/KCNE1-Antibody-(5B12)-ELISA-H00003753-M01-img0005.jpg)
![Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/KCNE1-Antibody-(5B12)-Western-Blot-H00003753-M01-img0001.jpg)
![Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/images2/KCNE1-Antibody-(5B12)-Western-Blot-H00003753-M01-img0004.jpg)
![Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.](http://images.novusbio.com/images2/CS-Citrate-Synthase-Antibody-(1761)-Western-Blot-NBP2-43648-img0008.jpg)
![Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000](http://images.novusbio.com/images2/CS-Citrate-Synthase-Antibody-(1761)-Western-Blot-NBP2-43648-img0010.jpg)
![Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/CS-Citrate-Synthase-Antibody-(1761)-Western-Blot-NBP2-43648-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: DHPS Antibody [NBP1-82648] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/DHPS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82648-img0007.jpg)
![Western Blot: DHPS Antibody [NBP1-82648] - Analysis in control (vector only transfected HEK293T lysate) and DHPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/DHPS-Antibody-Western-Blot-NBP1-82648-img0008.jpg)
![Immunohistochemistry-Paraffin: DHPS Antibody [NBP1-82648] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/DHPS-Antibody-Immunohistochemistry-Paraffin-NBP1-82648-img0009.jpg)
![Western Blot: MAP4K6 Antibody [NBP1-22990] - Wole cell lysate from HeLa and mouse NIH3T3 cells at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate.](http://images.novusbio.com/images2/MAP4K6-Antibody-Western-Blot-NBP1-22990-img0003.jpg)
![Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Epididymis shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Dehydrodolichyl-Diphosphate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87964-img0003.jpg)
![Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli.](http://images.novusbio.com/images2/Dehydrodolichyl-Diphosphate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87964-img0004.jpg)
![Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Rectum shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/Dehydrodolichyl-Diphosphate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87964-img0005.jpg)
![Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug C2C12 whole cell lysate/extract 7.5% SDS-PAGE . GALNS antibody dilution: 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/N-Acetylgalactosamine-6-Sulfatase-GALNS-Antibody-Western-Blot-NBP1-32899-img0010.jpg)
![Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract7.5% SDS-PAGE GALNS antibody dilution: 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/N-Acetylgalactosamine-6-Sulfatase-GALNS-Antibody-Western-Blot-NBP1-32899-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.](http://images.novusbio.com/images2/N-Acetylgalactosamine-6-Sulfatase-GALNS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-32899-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")