OTOS Antibody (6C6) - Azide and BSA Free

Western Blot: OTOS Antibody (6C6) [H00150677-M02-100ug] - Western Blot detection against Immunogen (32.78 KDa) .

ELISA: OTOS Antibody (6C6) [H00150677-M02-100ug] - Detection limit for recombinant GST tagged OTOS is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6C6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OTOS Antibody (6C6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse OTOS Antibody (6C6) - Azide and BSA Free (H00150677-M02-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: OTOS (NP_683764.1, 26 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OTOS
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for OTOS Antibody (6C6) - Azide and BSA Free

• OTOSP
• otospiralin

Background

Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OTOS
• Entrez:
  • 150677(Human)
• OMIM:
  • 607877(Human)
• Uniprot:
  • NP_683764.1(Human)