OSTB Antibody - BSA Free

Western Blot: OSTB Antibody [NBP1-91108] - Analysis in human cell line CACO-2 and human cell line U-2 OS.

Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human liver shows no positivity in hepatocytes.

Western Blot: OSTB Antibody [NBP1-91108] - Analysis in human cell line CACO-2 and human cell line U-2 OS.

Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Analysis in human small intestine and liver tissues. Corresponding SLC51B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: OSTB Antibody [NBP1-91108] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OSTB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC51B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OSTB Protein (NBP1-91108PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OSTB Antibody - BSA Free

• FLJ26090
• MGC118960
• MGC118961
• organic solute transporter beta
• organic solute transporter subunit beta
• OSTB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for OSTB Antibody (NBP1-91108). (Showing 1 - 1 of 1 FAQ).

1. I really need the OST beta antibody for human since it is related with my current research. Can this OSTB antibody (NBP1-91108) be used for the application of WB?
   • I actually just did a search and was able to track down OSTB on our site. I don't know how I didn't find it the first time, but we do have 1 antibody against this target that gets great reports from lab tests and customer feedback. Please se our SLC51B products. This antibody actually has been validated in WB. I have an image that I will get on the datasheet. It takes about 24 to 48 hours to display, but this will be guaranteed. It looks like we see a band slightly above the predicted weight in transfected cells between 17 and 28 kDa.

Bioinformatics

• Gene Symbol: SLC51B