OSTalpha Antibody - BSA Free

Western Blot: OSTalpha Antibody [NBP1-57085] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

OSTalpha Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to OSTalpha (organic solute transporter alpha) The peptide sequence was selected from the middle region of OSTalpha. Peptide sequence LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC51A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26222700).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for OSTalpha Antibody - BSA Free

• MGC39807
• organic solute transporter alpha
• organic solute transporter subunit alpha
• OSTA
• OST-alpha

Background

OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.OSTalpha efficiently transports the major species of bile acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OSTalpha Antibody (NBP1-57085)(2)

Publications using NBP1-57085

• Li DK, Chaudhari SN, Lee Y et al. Inhibition of microbial deconjugation of micellar bile acids protects against intestinal permeability and liver injury Science advances 2022-08-26 [PMID: 36026454]
• Jeong ES, Kim G, Shin HJ et al. Increased serum bile acid concentration following low-dose chronic administration of thioacetamide in rats, as evidenced by metabolomic analysis Toxicol. Appl. Pharmacol. 2015-07-26 [PMID: 26222700] (WB, Rat)

Bioinformatics

• Gene Symbol: SLC51A
• Uniprot:
  • Q86UW1(Human)