OSTalpha Antibody

Images

 
Western Blot: OSTalpha Antibody [NBP1-57085] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OSTalpha Antibody Summary

Immunogen
Synthetic peptides corresponding to OSTalpha (organic solute transporter alpha) The peptide sequence was selected from the middle region of OSTalpha. Peptide sequence LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha.
Predicted Species
Canine (100%), Equine (100%), Rabbit (92%), Guinea Pig (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC51A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OSTalpha and was validated on Western blot.
Publications
Read Publication using
NBP1-57085 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26222700).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OSTalpha Antibody

  • MGC39807
  • organic solute transporter alpha
  • organic solute transporter subunit alpha
  • OSTA
  • OST-alpha

Background

OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.OSTalpha efficiently transports the major species of bile acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-46439
Species: Hu, Mu, Rt
Applications: WB, IHC
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NLS5411
Species: Hu, Mu, Rt, Ha, Pm, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-36987
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60109
Species: Hu
Applications: WB
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NBP2-27196
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Gp, Ma-Op, Pm, Rb, RM, Ze
Applications: WB, IHC, IHC-P, KD
NBP1-57085
Species: Hu, Rt, Ca, Eq, Gp, Rb
Applications: WB

Publications for OSTalpha Antibody (NBP1-57085)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for OSTalpha Antibody (NBP1-57085) (0)

There are no reviews for OSTalpha Antibody (NBP1-57085). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSTalpha Antibody (NBP1-57085) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OSTalpha Products

Bioinformatics Tool for OSTalpha Antibody (NBP1-57085)

Discover related pathways, diseases and genes to OSTalpha Antibody (NBP1-57085). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OSTalpha

There are no specific blogs for OSTalpha, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OSTalpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC51A
Uniprot