Phosphodiesterase 4D Antibody - BSA Free

Western Blot: Phosphodiesterase 4D Antibody [NBP1-92265] -Analysis in human cell lines HeLa and U2OS using Anti-PDE4D antibody. Corresponding PDE4D RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Analysis in human cell lines HeLa and U2OS using Anti-PDE4D antibody. Corresponding PDE4D RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Staining of human Placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human Kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Staining of human cell line HeLa shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Phosphodiesterase 4D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Phosphodiesterase 4D Antibody - BSA Free (NBP1-92265) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDE4D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Phosphodiesterase 4D Protein (NBP1-92265PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Phosphodiesterase 4D Antibody - BSA Free

• cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E3)
• cAMP-specific 3'-5'-cyclic phosphodiesterase 4D
• cAMP-specific phosphodiesterase PDE4D6
• DKFZp686M11213
• DPDE3
• Drosophila)
• dunce-like phosphodiesterase E3
• EC 3.1.4
• FLJ97311
• HSPDE4D
• PDE43
• PDE4D
• Phosphodiesterase 4D
• phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog
• phosphodiesterase 4D, cAMP-specific

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDE4D