ORC5L Antibody

Images

 
Western Blot: ORC5L Antibody [NBP2-83049] - WB Suggested Anti-ORC5 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORC5L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of ORC5L. Peptide sequence: TRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGIRGSIE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ORC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ORC5L Antibody

  • ORC5Lorigin recognition complex, subunit 5-like (yeast)
  • ORC5P
  • ORC5T
  • origin recognition complex subunit 5
  • origin recognition complex, subunit 5 (yeast homolog)-like
  • origin recognition complex, subunit 5 homolog (yeast)
  • origin recognition complex, subunit 5
  • origin recognition complex, subunit 5-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-09473
Species: Hu
Applications: WB
H00004999-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-31132
Species: Hu
Applications: ICC/IF, WB
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00023594-M04
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-796
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-56745
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
DDX0010P-100
Species: Ca, Hu
Applications: Flow-CS, Flow, Func, IHC, IHC-Fr, IP, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF4479
Species: Hu
Applications: IHC
NBP2-45267
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67897
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92102
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-288
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB

Publications for ORC5L Antibody (NBP2-83049) (0)

There are no publications for ORC5L Antibody (NBP2-83049).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC5L Antibody (NBP2-83049) (0)

There are no reviews for ORC5L Antibody (NBP2-83049). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ORC5L Antibody (NBP2-83049) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORC5L Products

Array NBP2-83049

Bioinformatics Tool for ORC5L Antibody (NBP2-83049)

Discover related pathways, diseases and genes to ORC5L Antibody (NBP2-83049). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC5L Antibody (NBP2-83049)

Discover more about diseases related to ORC5L Antibody (NBP2-83049).
 

Pathways for ORC5L Antibody (NBP2-83049)

View related products by pathway.

PTMs for ORC5L Antibody (NBP2-83049)

Learn more about PTMs related to ORC5L Antibody (NBP2-83049).

Blogs on ORC5L

There are no specific blogs for ORC5L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORC5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC5