OPHN1 Antibody

Images

 
Immunohistochemistry-Paraffin: OPHN1 Antibody [NBP1-88828] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OPHN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVTARRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPHN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OPHN1 Protein (NBP1-88828PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OPHN1 Antibody

  • ARHGAP41
  • mental retardation, X-linked 60
  • MRX60
  • oligophrenin 1
  • oligophrenin-1
  • oligophrenin-1, Rho-GTPase activating protein
  • OPN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for OPHN1 Antibody (NBP1-88828) (0)

There are no publications for OPHN1 Antibody (NBP1-88828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OPHN1 Antibody (NBP1-88828) (0)

There are no reviews for OPHN1 Antibody (NBP1-88828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OPHN1 Antibody (NBP1-88828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OPHN1 Products

Bioinformatics Tool for OPHN1 Antibody (NBP1-88828)

Discover related pathways, diseases and genes to OPHN1 Antibody (NBP1-88828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OPHN1 Antibody (NBP1-88828)

Discover more about diseases related to OPHN1 Antibody (NBP1-88828).
 

Pathways for OPHN1 Antibody (NBP1-88828)

View related products by pathway.

PTMs for OPHN1 Antibody (NBP1-88828)

Learn more about PTMs related to OPHN1 Antibody (NBP1-88828).
 

Research Areas for OPHN1 Antibody (NBP1-88828)

Find related products by research area.

Blogs on OPHN1

There are no specific blogs for OPHN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OPHN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPHN1