OPA3 Antibody

Images

 
Western Blot: OPA3 Antibody [NBP1-68964] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OPA3 Antibody Summary

Immunogen
Synthetic peptides corresponding to OPA3 (optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)) The peptide sequence was selected from the C terminal of OPA3. Peptide sequence SCLMLEYWRHQLQQRRKEKERRVAREALRGEVGHLGLALEEL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OPA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OPA3 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OPA3 Antibody

  • FLJ22187
  • FLJ25932
  • MGA3Optic atrophy 3 (Iraqi-Jewish 'optic atrophy plus')
  • MGC75494
  • optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
  • optic atrophy 3 protein

Background

The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-94031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3446
Species: Hu
Applications: WB
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
AF7417
Species: Hu
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-38364
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-55046
Species: Hu
Applications: WB
NBP1-57375
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68964
Species: Hu
Applications: WB

Publications for OPA3 Antibody (NBP1-68964) (0)

There are no publications for OPA3 Antibody (NBP1-68964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OPA3 Antibody (NBP1-68964) (0)

There are no reviews for OPA3 Antibody (NBP1-68964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OPA3 Antibody (NBP1-68964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OPA3 Products

Bioinformatics Tool for OPA3 Antibody (NBP1-68964)

Discover related pathways, diseases and genes to OPA3 Antibody (NBP1-68964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OPA3 Antibody (NBP1-68964)

Discover more about diseases related to OPA3 Antibody (NBP1-68964).
 

Pathways for OPA3 Antibody (NBP1-68964)

View related products by pathway.

PTMs for OPA3 Antibody (NBP1-68964)

Learn more about PTMs related to OPA3 Antibody (NBP1-68964).
 

Research Areas for OPA3 Antibody (NBP1-68964)

Find related products by research area.

Blogs on OPA3

There are no specific blogs for OPA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OPA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OPA3