OIP106 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OIP106 Antibody [NBP2-55205] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OIP106 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSNLNLVD
Specificity
Specificity of human OIP106 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OIP106 Recombinant Protein Antigen (NBP2-55205PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for OIP106 Antibody

  • 106 kDa O-GlcNAc transferase-interacting protein
  • KIAA1042OGT(O-Glc-NAc transferase)-interacting protein 106 KDa
  • OIP106OGT(O Glc NAc transferase) interacting protein 106 KDa
  • trafficking kinesin-binding protein 1
  • trafficking protein, kinesin binding 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, Tumorsphere
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59021
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21667
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-87429
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-76816
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-55205
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for OIP106 Antibody (NBP2-55205) (0)

There are no publications for OIP106 Antibody (NBP2-55205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OIP106 Antibody (NBP2-55205) (0)

There are no reviews for OIP106 Antibody (NBP2-55205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OIP106 Antibody (NBP2-55205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OIP106 Products

Bioinformatics Tool for OIP106 Antibody (NBP2-55205)

Discover related pathways, diseases and genes to OIP106 Antibody (NBP2-55205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OIP106 Antibody (NBP2-55205)

Discover more about diseases related to OIP106 Antibody (NBP2-55205).
 

Pathways for OIP106 Antibody (NBP2-55205)

View related products by pathway.

Blogs on OIP106

There are no specific blogs for OIP106, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OIP106 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAK1