RHOT2 Antibody

Images

 
Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Simple Western: RHOT2 Antibody [NBP1-88982] - Simple Western lane view shows a specific band for RHOT2 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: RHOT2 Antibody [NBP1-88982] - Electropherogram image(s) of corresponding Simple Western lane view. RHOT2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHOT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC
Specificity
Specificity of human RHOT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB, ICC/IF reported in the literature (PMID:24671417). Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Control
RHOT2 Knockout HeLa Cell Lysate
Control Peptide
RHOT2 Protein (NBP1-88982PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88982 in the following applications:

Publications
Read Publication using
NBP1-88982 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24671417).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHOT2 Antibody

  • ARHT2
  • C16orf39
  • chromosome 16 open reading frame 39
  • EC 3.6.5
  • EC 3.6.5.-
  • hMiro-2
  • MIRO-2mitochondrial Rho 2
  • mitochondrial Rho GTPase 2
  • Ras homolog gene family member T2
  • ras homolog gene family, member T2
  • RASL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59021
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-59333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP1-56761
Species: Hu
Applications: WB
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, KD
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, IHC-FrFl, KD, KO, LA
NBP2-54955
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
BC100-494
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
NBP2-47466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71775
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RHOT2 Antibody (NBP1-88982)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for RHOT2 Antibody (NBP1-88982) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-88982:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Anonymous
WB Human 04/11/2019
View

Summary

ApplicationWestern Blot
Sample TestedTissue Lysates
SpeciesHuman
LotA91902

Comments

CommentsWestern blot analysis of meningioma tumour (whole) tumour lysates yielded strong/clear bands at the predicted molecular weight. highly recommended Ab

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RHOT2 Antibody (NBP1-88982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RHOT2 Products

Bioinformatics Tool for RHOT2 Antibody (NBP1-88982)

Discover related pathways, diseases and genes to RHOT2 Antibody (NBP1-88982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHOT2 Antibody (NBP1-88982)

Discover more about diseases related to RHOT2 Antibody (NBP1-88982).
 

Pathways for RHOT2 Antibody (NBP1-88982)

View related products by pathway.

PTMs for RHOT2 Antibody (NBP1-88982)

Learn more about PTMs related to RHOT2 Antibody (NBP1-88982).
 

Research Areas for RHOT2 Antibody (NBP1-88982)

Find related products by research area.

Blogs on RHOT2

There are no specific blogs for RHOT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
04/11/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol RHOT2