| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RHOT2 Antibody - BSA Free (NBP1-88982) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-RHOT2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RHOT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB, ICC/IF reported in the literature (PMID:24671417). ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 75 kDa |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88982 | Applications | Species |
|---|---|---|
| Birsa N, Norkett R, Wauer T et al. Lysine 27 Ubiquitination of the Mitochondrial Transport Protein Miro Is Dependent on Serine 65 of the Parkin Ubiquitin Ligase. J Biol Chem 2014-05-23 [PMID: 24671417] (WB, ICC/IF, Human) | WB, ICC/IF | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
WB | Human | 04/11/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for RHOT2 Antibody (NBP1-88982)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RHOT2 |