Home » Rhot1 » Rhot1 Antibodies » Rhot1 Antibody

Rhot1 Antibody

 (4 Publications)
 (4 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - HepG2 cell lysate, concentration 1.0ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - RHOT1 Antibody Titration: 2 ug/ml Positive Control: mouse brain/ human neuroblastoma cell line
Western Blot: Rhot1 Antibody [NBP1-59021] - Antibody Titration: 1 ug/ml Human A549.
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Rhot1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Equine (100%), Canine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Zebrafish (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
Rhot1 Knockout HeLa Cell Lysate
Reviewed Applications
Read 4 Reviews rated 4
using
NBP1-59021 in the following applications:
Publications
Read Publications using
NBP1-59021 in the following applications:

  • WB
    3 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26558789).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rhot1 Antibody

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1

Background

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RHOT2 Antibody
NBP1-88982
Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.
Immunocytochemistry/Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
ALS2CR3 Antibody
(S390-43)
NBP2-59333
Western Blot: ALS2CR3 Antibody (S390-43) [NBP2-59333] - Analysis of Rat Brain-Membrane showing detection of ~ 100 kDa TRAK2 protein using Mouse Anti-TRAK2 Monoclonal Antibody, Clone S390-43. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane. Load: 15 ug protein. Block: 2% GE Healthcare Blocker for 1 hour at RT. Primary Antibody: Mouse Anti-TRAK2 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~ 100 kDa.
Immunocytochemistry/Immunofluorescence: ALS2CR3 Antibody (S390-43) [NBP2-59333] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Trak2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000; 1:5000 for 60 min RT, 5 min RT. Localization: Cytoplasm. Magnification: 60X.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Mitofusin 2
Antibody (4H8)
H00009927-M03
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 expression in PC-12 (Cat # L012V1).
Immunohistochemistry-Paraffin: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 5 ug/ml
Western Blot: Mitofusin 2 Antibody (4H8) [H00009927-M03] - Analysis of MFN2 over-expressed 293 cell line, cotransfected with MFN2 Validated Chimera RNAi ( Cat # H00009927-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MFN2 monoclonal antibody (M03), clone 4H8 (Cat # H00009927-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(1 Review)
(23 Publications)
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, RNAi
Kinesin 5B Antibody
NBP2-21667
Western Blot: Kinesin 5B Antibody [NBP2-21667] - Glucocorticoid promoted microtubule destabilization and following transport impairment. The hippocampus of mice exposed to rapamycin (8 mg/kg) for 2 days before corticosterone (10 mg/kg) for 24 h was collected and lysed. alpha-tubulin was co-immunoprecipitated with an anti-kinesin-1 antibody (the left side). Expression of kinesin-1 and alpha-tubulin in total cell lysates is shown in the right side. ** indicates p < 0.01 vs. vehicle. # indicates p < 0.05 vs. corticosterone alone. n = 4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-018-1172-y) licensed under a CC-BY licence.
Immunohistochemistry: Kinesin Antibody [NBP2-21667] - 40X in human brain at pH 6. Tissue: Human Brain.
Western Blot: Kinesin Antibody [NBP2-21667] - Rabbit anti-Kinesin 1 Antibody. Lane 1: 500 ng of truncated kinesin 1 protein. Lane 2: 20 ug of Mouse Brain lysate. Lane 3: 10 ug of Mouse Brain lysate. kinesin1 antibody at 1:1000 for overnight at 4C. Secondary antibody: Dye800 rabbit secondary antibody at 1:40,000 for 1hr at RT. Block: 5% Blocking Buffer1 hr at RT. Predicted/Observed size: 72 kDa, ~70 kDa for kinesin-1. Other band: degradation.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
OIP106 Antibody
NBP1-56761
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HT1080.
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: OIP106 Antibody [NBP1-56761] - HCT15, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HCT15.
Species: Hu
Applications: WB
Rhodopsin Antibody
(B630)
NBP2-25160
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important to avoid boiling samples containing this protein in SDS-PAGE sample buffer, as this will result in even more extensive aggregation of the Rhodopsin protein and appearance of more of this high molecular weight material.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - Analysis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar pattern to independent antibody NBP1-89285 (B).
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum shows moderate positivity in mitochondria in Purkinje cells.
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-57642
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells and cells in granular layer.
Species: Hu
Applications: WB, IHC, IHC-P
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
RhoF Antibody
NBP2-20157
Western Blot: RhoF Antibody [NBP2-20157] - Mouse tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with RHOF antibody [N1C3] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: RhoF Antibody [NBP2-20157] - Immunohistochemical analysis of paraffin-embedded colon ca, using antibody at 1:500 dilution.
Western Blot: RhoF Antibody [NBP2-20157] - Sample (30 ug of whole cell lysate) A: U87-MG 12% SDS PAGE gel, diluted at 1:500.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
VAP-B Antibody
NBP1-89112
Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in human cell lines Caco-2 and HEK293 using anti-VAPB antibody. Corresponding VAPB RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.
Immunocytochemistry/Immunofluorescence: VAP-B Antibody [NBP1-89112] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
KIF1B Antibody
NB100-57493
Western Blot: KIF1B Antibody [NB100-57493] - Detection of Human and Mouse KIF1B on HeLa whole cell lysate using NB100-57493. KIF1B was also immunoprecipitated by rabbit anti-KIF1B antibody NB100-57494.
(3 Publications)
Species: Hu, Mu
Applications: WB, IP
Mitofusin 1
Antibody (11E9-1H12)
NBP1-71775
Western Blot: Mitofusin 1 Antibody (11E9-1H12) [NBP1-71775] - Analysis of Mitofusin-1 expression in (1) MEF wild-type and (2) MEF Mitofusin-1-null whole cell lysates using NBP1-71775.
Immunocytochemistry/Immunofluorescence: Mitofusin 1 Antibody (11E9-1H12) [NBP1-71775] - Antibody was tested in 3T3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: Mitofusin 1 Antibody (11E9-1H12) [NBP1-71775] - Analysis of Mitofusin-1 in mouse liver.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
OPA1 Antibody
NB110-55290
Simple Western: OPA1 Antibody [NB110-55290] - Lane view shows a specific band for OPA1 in 0.5 mg/ml of MEF lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: OPA1 Antibody [NB110-55290] - Depletion of Oma1 in fish affects development. Immunoblot of protein extracts from injected fish (yolk removed) at 24, 48 and 72 hpf. Expression of Oma1, Opa1 isoforms (a-f) and Cox4 (mitochondrial abundance marker) was analyzed with respective antibodies. Actin and Ponceau S staining were loading controls. Source data (full-length blots) are available online in Supplementary information. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep13989), licensed under a CC-BY licence.
Western Blot: OPA1 Antibody [NB110-55290] - Total protein from Human HeLa cells, Mouse MEF cells and Rat Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-OPA1 in 1% blocking buffer. Precision Plus Protein All Blue molecular weight markers (BioRad) were detected with 1 ug/ml Anti-Blue Marker antibody (NBP2-33376). The protein ladder was detected with an anti-mouse HRP secondary antibody and OPA1 with an anti-rabbit HRP secondary antibody using chemiluminescence.
(2 Reviews)
(26 Publications)
Species: Hu, Mu, Rt, Po, Ch, Ze
Applications: WB, Simple Western, IB, IHC, IHC-P
ARMCX3 Antibody
NBP1-89142
Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ARMCX3 Antibody [NBP1-89142] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TOMM20 Antibody
NBP1-81556
Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in human cell lines HEK293 and MCF-7. Corresponding TOMM20 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Z-stack confocal images with SRRF (super-resolution radial fluctuations) analysis of Tomm20, an outer mitochondrial membrane protein, in HeLa cells. Tomm20 was detected in HeLa cells using 1 ug/ml Rb anti-Tomm20 (NBP1-81556) and 1:500 JF646-conjugated anti-Rb secondary antibody (red). Cells were counterstained with Dapi (blue). Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.
(3 Reviews)
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Rhot1 Antibody (NBP1-59021)(4)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(2)
Rat
(1)
All Species

Reviews for Rhot1 Antibody (NBP1-59021) (4) 44

Average Rating: 4
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-59021:
Filter by Applications
WB
(3)
IHC-P
(1)
All Applications
Filter by Species
Human
(2)
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Rhot1 NBP1-59021
Enlarge 		4
reviewed by:
Anonymous
 WB Human 03/07/2016
View

Summary

ApplicationWestern Blot
Sample Testedhuman whole cell lysates
SpeciesHuman
LotQC41365

Blocking

Blocking Details1 hr using 5% milk at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#1706515
Secondary Concentration1:10,000

Details

Detection NotesECL based detection using Chemidoc MP, 2 minutes.
Immunohistochemistry-Paraffin Rhot1 NBP1-59021
Enlarge 		4
reviewed by:
Anonymous
 IHC-P Mouse 06/02/2015
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedMouse lung sections paraffin embedded
SpeciesMouse
LotQC41365
Western Blot Rhot1 NBP1-59021
Enlarge 		4
reviewed by:
Anonymous
 WB Mouse 06/02/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse lung homogenates
SpeciesMouse
LotQC41365

Blocking

Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000

Details

Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure
Western Blot Rhot1 NBP1-59021
Enlarge 		4
reviewed by:
Anonymous
 WB Human 05/29/2015
View

Summary

ApplicationWestern Blot
Sample TestedLung homogenates
SpeciesHuman
LotQC41365

Blocking

Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000

Details

Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rhot1 Antibody (NBP1-59021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Rhot1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Rhot1 Products

Bioinformatics Tool for Rhot1 Antibody (NBP1-59021)

Discover related pathways, diseases and genes to Rhot1 Antibody (NBP1-59021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (NBP1-59021)

Discover more about diseases related to Rhot1 Antibody (NBP1-59021).
 

Pathways for Rhot1 Antibody (NBP1-59021)

View related products by pathway.

PTMs for Rhot1 Antibody (NBP1-59021)

Learn more about PTMs related to Rhot1 Antibody (NBP1-59021).
 

Research Areas for Rhot1 Antibody (NBP1-59021)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
4
3
0
2
0
1
0
Western Blot Rhot1 NBP1-59021
Enlarge
 Anonymous
03/07/2016
Application: WB
Species: Human
read this review
Immunohistochemistry-Paraffin Rhot1 NBP1-59021
Enlarge
 Anonymous
06/02/2015
Application: IHC-P
Species: Mouse
read this review
Western Blot Rhot1 NBP1-59021
Enlarge
 Anonymous
06/02/2015
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol RHOT1
Entrez
Uniprot