Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER. The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Equine (100%), Canine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Zebrafish (93%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RHOT1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | This is a rabbit polyclonal antibody against RHOT1 and was validated on Western Blot and immunohistochemistry-paraffin |
||
Theoretical MW | 71 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Human | 03/07/2016 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
||||||||||||||||||||
Enlarge |
reviewed by:
Anonymous |
IHC-P | Mouse | 06/02/2015 |
Summary
|
||||||||||||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 06/02/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
||||||||||||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Human | 05/29/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
Secondary Antibodies |
Isotype Controls |
Diseases for Rhot1 Antibody (NBP1-59021)Discover more about diseases related to Rhot1 Antibody (NBP1-59021).
| Pathways for Rhot1 Antibody (NBP1-59021)View related products by pathway.
|
PTMs for Rhot1 Antibody (NBP1-59021)Learn more about PTMs related to Rhot1 Antibody (NBP1-59021).
| Research Areas for Rhot1 Antibody (NBP1-59021)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Anonymous 03/07/2016 |
||
Application: | WB | |
Species: | Human |
Anonymous 06/02/2015 |
||
Application: | IHC-P | |
Species: | Mouse |
Anonymous 06/02/2015 |
||
Application: | WB | |
Species: | Mouse |