Rhot1 Antibody


Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - HepG2 cell lysate, concentration 1.0ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - RHOT1 Antibody Titration: 2 ug/ml Positive Control: mouse brain/ human neuroblastoma cell line
Western Blot: Rhot1 Antibody [NBP1-59021] - Antibody Titration: 1 ug/ml Human A549.
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Rhot1 Antibody Summary

Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Rhot1 Lysate (NBP2-65343)
Reviewed Applications
Read 4 Reviews rated 4
NBP1-59021 in the following applications:

Read Publications using
NBP1-59021 in the following applications:

  • WB
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 26558789).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rhot1 Antibody

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1


Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Mu, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Ze
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Rhot1 Antibody (NBP1-59021)(3)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Rhot1 Antibody (NBP1-59021) (4) 44

Average Rating: 4
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-59021:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Rhot1 NBP1-59021
reviewed by:
WB Human 03/07/2016


ApplicationWestern Blot
Sample Testedhuman whole cell lysates


Blocking Details1 hr using 5% milk at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#1706515
Secondary Concentration1:10,000


Detection NotesECL based detection using Chemidoc MP, 2 minutes.
Immunohistochemistry-Paraffin Rhot1 NBP1-59021
reviewed by:
IHC-P Mouse 06/02/2015


Sample TestedMouse lung sections paraffin embedded
Western Blot Rhot1 NBP1-59021
reviewed by:
WB Mouse 06/02/2015


ApplicationWestern Blot
Sample TestedMouse lung homogenates


Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000


Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure
Western Blot Rhot1 NBP1-59021
reviewed by:
WB Human 05/29/2015


ApplicationWestern Blot
Sample TestedLung homogenates


Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000


Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rhot1 Antibody (NBP1-59021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Rhot1 Antibody (NBP1-59021)

Discover related pathways, diseases and genes to Rhot1 Antibody (NBP1-59021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (NBP1-59021)

Discover more about diseases related to Rhot1 Antibody (NBP1-59021).

Pathways for Rhot1 Antibody (NBP1-59021)

View related products by pathway.

PTMs for Rhot1 Antibody (NBP1-59021)

Learn more about PTMs related to Rhot1 Antibody (NBP1-59021).

Research Areas for Rhot1 Antibody (NBP1-59021)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human

Application: IHC-P
Species: Mouse

Application: WB
Species: Mouse


Gene Symbol RHOT1