Home » Rhot1 » Rhot1 Antibodies » Rhot1 Antibody

Rhot1 Antibody

 (3 Publications)
 (4 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry-Paraffin: Rhot1 Antibody [NBP1-59021] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - HepG2 cell lysate, concentration 1.0ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59021] - RHOT1 Antibody Titration: 2 ug/ml Positive Control: mouse brain/ human neuroblastoma cell line
Western Blot: Rhot1 Antibody [NBP1-59021] - Antibody Titration: 1 ug/ml Human A549.
Western Blot: Rhot1 Antibody [NBP1-59021] - Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Rhot1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Rhot1 Lysate (NBP2-65343)
Reviewed Applications
Read 4 Reviews rated 4
using
NBP1-59021 in the following applications:
Publications
Read Publications using
NBP1-59021 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rhot1 Antibody

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1

Background

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RHOT2 Antibody
NBP1-88982
Western Blot: RHOT2 Antibody [NBP1-88982] - Analysis in human cell line HEK 293.
Immunocytochemistry/Immunofluorescence: RHOT2 Antibody [NBP1-88982] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RHOT2 Antibody [NBP1-88982] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
ALS2CR3 Antibody
(S390-43)
NBP2-59333
Western Blot: ALS2CR3 Antibody (S390-43) [NBP2-59333] - Analysis of Rat Brain-Membrane showing detection of ~ 100 kDa TRAK2 protein using Mouse Anti-TRAK2 Monoclonal Antibody, Clone S390-43. Lane 1: MW Ladder. Lane 2: Rat Brain Membrane. Load: 15 ug protein. Block: 2% GE Healthcare Blocker for 1 hour at RT. Primary Antibody: Mouse Anti-TRAK2 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~ 100 kDa.
Immunocytochemistry/Immunofluorescence: ALS2CR3 Antibody (S390-43) [NBP2-59333] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Trak2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000; 1:5000 for 60 min RT, 5 min RT. Localization: Cytoplasm. Magnification: 60X.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Mitofusin 2
Antibody
NBP2-66383
Western Blot: Mitofusin 2 Antibody [NBP2-66383] - Total protein from human HeLa and A431, mouse Neuro2A and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/ml anti-MFN2 in block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Mitofusin 2 Antibody [NBP2-66383] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Mitofusin 2 at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Mitofusin 2 Antibody [NBP2-66383] - IHC analysis of a formalin fixed paraffin embedded (FFPE) tissue section of mouse heart using Mitofusin 2/MFN2 antibody at 5ug/ml concentration (1:200 dilution). The primary antibody binding to MFN2 antigen was detected using HRP conjugated anti-rabbit secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This MFN2 antibody generated a diffused to punctate cytoplasmic staining of mitochondria in the cardiac muscles (brown color). The nuclei of the muscle cells and the macrophages are stained blue in this representative image (this 40X image is of a transverse section of heart tissue).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Kinesin 5B Antibody
NB100-1059
Western Blot: Kinesin 5B Antibody [NB100-1059] - (0.03ug/ml) staining of lysates of cell line HeLa (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NB100-1059] - (1ug/ml) staining of paraffin embedded Human Kidney. Microwaved antigen retrieval with Tris/EDTA buffer pH9, HRP-staining. Please note this data was obtained with a previous batch.
Immunohistochemistry-Paraffin: Kinesin 5B Antibody [NB100-1059] - (2.5ug/ml) staining of paraffin embedded Human Uterus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining. Please note this data was obtained with a previous batch.
(2 Publications)
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
OIP106 Antibody
NBP1-56761
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HT1080.
Western Blot: OIP106 Antibody [NBP1-56761] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: OIP106 Antibody [NBP1-56761] - HCT15, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that TRAK1 is expressed in HCT15.
Species: Hu
Applications: WB
Rhodopsin Antibody
(A531)
NBP2-25159
Western Blot: Rhodopsin Antibody (A531) [NBP2-25159] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important not to boil a sample containing it in SDS-PAGE sample buffer, as this will result in more extensive aggregation of the Rhodopsin protein.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (A531) [NBP2-25159] - Pig retinal section stained with NBP2-25159 (green) and counterstained with rabbit polyclonal antibody to NF-M NB300-133 (red) and DNA (blue). Rhodopsin is most abundant in the outer segments of retina (OS), NF-M is abundant in the optic nerve fiber layer (ONFL), but seen in processes and neurons in other regions also. Other layers are pigmented epithelium (PE), outer and inner nuclear layers (ONL, INL), outer and inner plexiform layers (OPL, IPL) and ganglion cell layer (GCL).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-57642
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: WB, IHC, IHC-P
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
RhoF Antibody
(1D4B6)
NBP2-52553
Western Blot: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis using RHOF mAb against human RHOF (AA: 1-84) recombinant protein. (Expected MW is 34.9 kDa)
Flow Cytometry: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis of Hela cells using RHOF mouse mAb (green) and negative control (red).
Western Blot: RhoF Antibody (1D4B6) [NBP2-52553] - Analysis using RHOF mAb against HEK293 (1) and RHOF (AA: 1-84)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
VAP-B Antibody
NBP1-89112
Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in human cell lines Caco-2 and HEK293 using anti-VAPB antibody. Corresponding VAPB RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.
Immunocytochemistry/Immunofluorescence: VAP-B Antibody [NBP1-89112] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining in human cerebral cortex and liver tissues. Corresponding VAPB RNA-seq data are presented for the same tissues.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KIF1B Antibody
NB100-57493
Western Blot: KIF1B Antibody [NB100-57493] - Detection of Human and Mouse KIF1B on HeLa whole cell lysate using NB100-57493. KIF1B was also immunoprecipitated by rabbit anti-KIF1B antibody NB100-57494.
(3 Publications)
Species: Hu, Mu
Applications: WB, IP
Mitofusin 1
Antibody (3C9)
H00055669-M04
Western Blot: Mitofusin 1 Antibody (3C9) [H00055669-M04] - Analysis of MFN1 expression in HepG2.
Western Blot: Mitofusin 1 Antibody (3C9) [H00055669-M04] - MFN1 monoclonal antibody (M04), clone 3C9 Western Blot analysis of MFN1 expression in HeLa ( Cat # L013V1 ).
Western Blot: Mitofusin 1 Antibody (3C9) [H00055669-M04] - Western blot analysis of MFN1 over-expressed 293 cell line, cotransfected with MFN1 Validated Chimera RNAi or non-transfected control. Blot probed with H00055669-M04. GAPDH (36.1 kDa) used as loading control.
(21 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow
OPA1 Antibody
NB110-55290
Western Blot: OPA1 Antibody [NB110-55290] - Total protein from Human HeLa cells, Mouse MEF cells and Rat Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-OPA1 in 1% blocking buffer. Precision Plus Protein All Blue molecular weight markers (BioRad) were detected with 1 ug/ml Anti-Blue Marker antibody (NBP2-33376). The protein ladder was detected with an anti-mouse HRP secondary antibody and OPA1 with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry: OPA1 Antibody [NB110-55290] - Staining in prostatic smooth muscle and glandular epithelium. Human Prostate 40X magnification.
Western Blot: OPA1 Antibody [NB110-55290] - Detection of OPA1 protein in post-nuclear extracts of mouse embryonic fibroblasts.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
ARMCX3 Antibody
NBP1-89142
Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ARMCX3 Antibody [NBP1-89142] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ARMCX3 Antibody [NBP1-89142] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TOMM20 Antibody
NBP1-81556
Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Rhot1 Antibody (NBP1-59021)(3)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Rhot1 Antibody (NBP1-59021) (4) 44

Average Rating: 4
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-59021:
Filter by Applications
WB
(3)
IHC-P
(1)
All Applications
Filter by Species
Human
(2)
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Rhot1 NBP1-59021
Enlarge
reviewed by:
Anonymous
 WB Human 03/07/2016
View

Summary

ApplicationWestern Blot
Sample Testedhuman whole cell lysates
SpeciesHuman
LotQC41365

Blocking

Blocking Details1 hr using 5% milk at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#1706515
Secondary Concentration1:10,000

Details

Detection NotesECL based detection using Chemidoc MP, 2 minutes.
Immunohistochemistry-Paraffin Rhot1 NBP1-59021
Enlarge
reviewed by:
Anonymous
 IHC-P Mouse 06/02/2015
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedMouse lung sections paraffin embedded
SpeciesMouse
LotQC41365
Western Blot Rhot1 NBP1-59021
Enlarge
reviewed by:
Anonymous
 WB Mouse 06/02/2015
View

Summary

ApplicationWestern Blot
Sample TestedMouse lung homogenates
SpeciesMouse
LotQC41365

Blocking

Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000

Details

Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure
Western Blot Rhot1 NBP1-59021
Enlarge
reviewed by:
Anonymous
 WB Human 05/29/2015
View

Summary

ApplicationWestern Blot
Sample TestedLung homogenates
SpeciesHuman
LotQC41365

Blocking

Blocking Details5% Milk at Room Temperature for 1 hr

Primary Anitbody

Dilution Ratio1:1000 dilution at 4 degree for 16 hrs

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP secondary Ab.
Secondary Manufacturer Cat#170-6515
Secondary Concentration1:10,000

Details

Detection NotesBio-Rad Chemidoc MP, 10-60 sec exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rhot1 Antibody (NBP1-59021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Rhot1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Rhot1 Antibody (NBP1-59021)

Discover related pathways, diseases and genes to Rhot1 Antibody (NBP1-59021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (NBP1-59021)

Discover more about diseases related to Rhot1 Antibody (NBP1-59021).
 

Pathways for Rhot1 Antibody (NBP1-59021)

View related products by pathway.

PTMs for Rhot1 Antibody (NBP1-59021)

Learn more about PTMs related to Rhot1 Antibody (NBP1-59021).
 

Research Areas for Rhot1 Antibody (NBP1-59021)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
4
3
0
2
0
1
0
Western Blot Rhot1 NBP1-59021
Enlarge
 Anonymous
03/07/2016
Application: WB
Species: Human
read this review
Immunohistochemistry-Paraffin Rhot1 NBP1-59021
Enlarge
 Anonymous
06/02/2015
Application: IHC-P
Species: Mouse
read this review
Western Blot Rhot1 NBP1-59021
Enlarge
 Anonymous
06/02/2015
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol RHOT1
Entrez
Uniprot