OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen

Images

 
There are currently no images for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLCO1B3.

Source: E. coli

Amino Acid Sequence: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLCO1B3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-61636.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen

  • Liver-specific organic anion transporter 2
  • liver-specific organic anion transporter 3TM13
  • LST2
  • LST-2
  • LST3
  • OATP1B3
  • OATP1B3LST-3TM13
  • OATP8
  • OATP-8
  • Organic anion transporter 8
  • organic anion transporter LST-3c
  • Organic anion-transporting polypeptide 8
  • SLC21A8
  • SLCO1B3
  • solute carrier family 21 (organic anion transporter), member 8
  • Solute carrier family 21 member 8
  • solute carrier organic anion transporter family member 1B3
  • solute carrier organic anion transporter family, member 1B3

Background

The OATPs (organic anion transporter polypeptides) are a family of transport proteins that have been found to mediate the uptake of organic ions into hepatocyte cells. These proteins fall into the solute carrier family 21A (SLC21A), and are expressed in liver, kidney, and brain. These polypeptides are involved in the excretion of potentially toxic compounds and therefore play a role in the overall detoxification system of the body. Unlike other members of the OATP family, OATP2 and 8 have been detected exclusively in the liver, and there is an 80% amino acid sequence homology between these polypeptides. Other names for OATP2 include SLC21A6, OATP-C, and LST-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-85770
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP1-59811
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
4014-SP
Species: Hu
Applications: BA
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB

Publications for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP) (0)

There are no publications for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP) (0)

There are no reviews for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OATP1B3/SLCO1B3/OATP8 Products

Research Areas for OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen (NBP2-61636PEP)

Find related products by research area.

Blogs on OATP1B3/SLCO1B3/OATP8.

OATP8 - A membrane transport protein responsible for cancer drug uptake
Human hepatocytes express important transport proteins that are responsible for the uptake and removal of organic anions from the blood. These proteins are members of the organic anion-transporting polypeptide (OATP) family and are essential for pr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OATP1B3/SLCO1B3/OATP8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO1B3