Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clone | 6D4I4 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Description | Novus Biologicals Rabbit NuMA Antibody (6D4I4) (NBP3-16411) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2000-2100 of human NuMA1 (Q14980). TPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA |
Source | HEK293 |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | NUMA1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NuMA Antibody (NBP3-16411)Find related products by research area.
|
NuMA: The Key to Asymmetric Cell Division Nuclear Mitotic Apparatus protein (NuMA) is a cell cycle-related protein that acts as an organizer of the mitotic spindle during mitosis. It may be involved in coordinating the alignment of the mitotic spindle to the cellular polarity axis, which is a... Read full blog post. |
Nucleus and Mitotic Apparatus (NuMA) Protein in Cell Cycle Regulation NuMA, the major protein of the "Nucleus and Mitotic Apparatus", is a structural protein in vertebrates involved in cell cycle regulation. It localizes to the nucleus during interphase, and accumulates at the spindle poles during mitosis and NuMA has b... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NUMA1 |