Nuf2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nuf2 Antibody [NBP2-55985] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nuf2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
Specificity
Specificity of human Nuf2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nuf2 Recombinant Protein Antigen (NBP2-55985PEP)

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nuf2 Antibody

  • cancer/testis antigen 106
  • CDCA1hsNuf2
  • cell division cycle associated 1
  • Cell division cycle-associated protein 1
  • CT106
  • hNuf2
  • kinetochore protein Nuf2
  • NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  • NUF2RhNuf2R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-338
Species: Hu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88626
Species: Hu
Applications: IHC, IHC-P
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003833-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-73624
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Nuf2 Antibody (NBP2-55985) (0)

There are no publications for Nuf2 Antibody (NBP2-55985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nuf2 Antibody (NBP2-55985) (0)

There are no reviews for Nuf2 Antibody (NBP2-55985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nuf2 Antibody (NBP2-55985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nuf2 Products

Bioinformatics Tool for Nuf2 Antibody (NBP2-55985)

Discover related pathways, diseases and genes to Nuf2 Antibody (NBP2-55985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nuf2 Antibody (NBP2-55985)

Discover more about diseases related to Nuf2 Antibody (NBP2-55985).
 

Pathways for Nuf2 Antibody (NBP2-55985)

View related products by pathway.

PTMs for Nuf2 Antibody (NBP2-55985)

Learn more about PTMs related to Nuf2 Antibody (NBP2-55985).
 

Research Areas for Nuf2 Antibody (NBP2-55985)

Find related products by research area.

Blogs on Nuf2

There are no specific blogs for Nuf2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nuf2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUF2