CENPI Antibody

Images

 
Staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.
Analysis in human cell line RT-4 and human cell line U-251 MG.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPI Antibody Summary

Immunogen
This antibody has been engineered to specifically recognize the recombinant protein CENPI using the following amino acid sequence: PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPI
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CENPI Antibody

  • CENP-IFSH primary response (LRPR1, rat) homolog 1
  • centromere protein I
  • Follicle-stimulating hormone primary response protein
  • FSH primary response 1
  • FSH primary response protein 1
  • FSHPRH1Mis6
  • ICEN19
  • Interphase centromere complex protein 19
  • Leucine-rich primary response protein 1
  • LRPR1FSH primary response (LRPR1 homolog, rat) 1
  • Mis6

Background

The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CENPI Antibody (NBP3-24732) (0)

There are no publications for CENPI Antibody (NBP3-24732).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPI Antibody (NBP3-24732) (0)

There are no reviews for CENPI Antibody (NBP3-24732). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CENPI Antibody (NBP3-24732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPI