NUDT21 Antibody


Western Blot: NUDT21 Antibody [NBP2-57491] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NUDT21 Antibody [NBP2-57491] - Staining of human cell line PC-3 shows localization to nuclear bodies.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

NUDT21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG
Specificity of human NUDT21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUDT21 Recombinant Protein Antigen (NBP2-57491PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NUDT21 Antibody

  • CFIm25
  • CFIM25CPSF 25 kDa subunit
  • cleavage and polyadenylation specific factor 5, 25 kD subunit
  • cleavage and polyadenylation specific factor 5, 25 kDa
  • Cleavage and polyadenylation specificity factor 25 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 5
  • CPSF25
  • CPSF5DKFZp686H1588
  • Nucleoside diphosphate-linked moiety X motif 21
  • nudix (nucleoside diphosphate linked moiety X)-type motif 21
  • Nudix motif 21
  • pre-mRNA cleavage factor Im (25kD)
  • Pre-mRNA cleavage factor Im 25 kDa subunit
  • pre-mRNA cleavage factor Im, 25kD subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB (-), IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu

Publications for NUDT21 Antibody (NBP2-57491) (0)

There are no publications for NUDT21 Antibody (NBP2-57491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT21 Antibody (NBP2-57491) (0)

There are no reviews for NUDT21 Antibody (NBP2-57491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NUDT21 Antibody (NBP2-57491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NUDT21 Antibody (NBP2-57491)

Discover related pathways, diseases and genes to NUDT21 Antibody (NBP2-57491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT21 Antibody (NBP2-57491)

Discover more about diseases related to NUDT21 Antibody (NBP2-57491).

Pathways for NUDT21 Antibody (NBP2-57491)

View related products by pathway.

Blogs on NUDT21

There are no specific blogs for NUDT21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDT21 Antibody and receive a gift card or discount.


Gene Symbol NUDT21