NUDT21 Antibody - BSA Free

Western Blot: NUDT21 Antibody [NBP1-57540] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: NUDT21 Antibody [NBP1-57540] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NUDT21 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NUDT21 (nudix (nucleoside diphosphate linked moiety X)-type motif 21) The peptide sequence was selected from the N terminal of NUDT21. Peptide sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 5.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT21
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NUDT21 Antibody - BSA Free

• CFIm25
• CFIM25CPSF 25 kDa subunit
• cleavage and polyadenylation specific factor 5, 25 kD subunit
• cleavage and polyadenylation specific factor 5, 25 kDa
• Cleavage and polyadenylation specificity factor 25 kDa subunit
• cleavage and polyadenylation specificity factor subunit 5
• CPSF25
• CPSF5DKFZp686H1588
• Nucleoside diphosphate-linked moiety X motif 21
• nudix (nucleoside diphosphate linked moiety X)-type motif 21
• Nudix motif 21
• pre-mRNA cleavage factor Im (25kD)
• Pre-mRNA cleavage factor Im 25 kDa subunit
• pre-mRNA cleavage factor Im, 25kD subunit

Background

NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT21
• Uniprot:
  • O43809(Human)