NUDT21 Antibody


Western Blot: NUDT21 Antibody [NBP1-57540] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: NUDT21 Antibody [NBP1-57540] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NUDT21 Antibody Summary

Synthetic peptides corresponding to NUDT21 (nudix (nucleoside diphosphate linked moiety X)-type motif 21) The peptide sequence was selected from the N terminal of NUDT21. Peptide sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
This product is specific to Subunit or Isoform: 5.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NUDT21 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NUDT21 Antibody

  • CFIm25
  • CFIM25CPSF 25 kDa subunit
  • cleavage and polyadenylation specific factor 5, 25 kD subunit
  • cleavage and polyadenylation specific factor 5, 25 kDa
  • Cleavage and polyadenylation specificity factor 25 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 5
  • CPSF25
  • CPSF5DKFZp686H1588
  • Nucleoside diphosphate-linked moiety X motif 21
  • nudix (nucleoside diphosphate linked moiety X)-type motif 21
  • Nudix motif 21
  • pre-mRNA cleavage factor Im (25kD)
  • Pre-mRNA cleavage factor Im 25 kDa subunit
  • pre-mRNA cleavage factor Im, 25kD subunit


NUDT21 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB (-), IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu

Publications for NUDT21 Antibody (NBP1-57540) (0)

There are no publications for NUDT21 Antibody (NBP1-57540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT21 Antibody (NBP1-57540) (0)

There are no reviews for NUDT21 Antibody (NBP1-57540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT21 Antibody (NBP1-57540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NUDT21 Products

Bioinformatics Tool for NUDT21 Antibody (NBP1-57540)

Discover related pathways, diseases and genes to NUDT21 Antibody (NBP1-57540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT21 Antibody (NBP1-57540)

Discover more about diseases related to NUDT21 Antibody (NBP1-57540).

Pathways for NUDT21 Antibody (NBP1-57540)

View related products by pathway.

Blogs on NUDT21

There are no specific blogs for NUDT21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NUDT21 Antibody and receive a gift card or discount.


Gene Symbol NUDT21