NUDCD3 Antibody - BSA Free

Western Blot: NUDCD3 Antibody [NBP3-09934] - Western blot analysis of NUDCD3 in Human Fetal Liver. Antibody dilution at 1 ug/mL

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NUDCD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDCD3 Antibody - BSA Free (NBP3-09934) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3 (NP_056147.2). Peptide sequence AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDCD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NUDCD3 Antibody - BSA Free

• KIAA1068NudCL
• NudC domain containing 3
• nudC domain-containing protein 3
• NudC-like protein

Background

The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDCD3