| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDA |
| Predicted Species | Mouse (90%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Nucleolin Antibody (NBP1-88271)Find related products by research area.
|
|
Nucleolin: A Multifaceted Nucleolar Phosphoprotein Nucleolin is a ubiquitous, nonhistone nucleolar phosphoprotein of exponentially growing eukaryotic cells and is present in abundance at the dense fibrillar and granular regions of nucleolus. Intact nucleolin is the major species and represents 5% of n... Read full blog post. |
|
Nucleolin Antibodies: Knowing When it's Time to Split Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ... Read full blog post. |
|
Nucleolin: To the Nucleus and Beyond! Nucleolin is a multifunctional phosphoprotein ubiquitously distributed in the nucleolus, nucleus and cytoplasm of the cell. Nucleolin has a bipartite nuclear localization signal sequence and is conserved across the species. Nucleolin levels are expres... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NCL |