Nucleolin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nucleolin Antibody [NBP1-88271] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: Nucleolin Antibody [NBP1-88271] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleolin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nucleolin Protein (NBP1-88271PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleolin Antibody

  • C23
  • FLJ45706
  • FLJ59041
  • nucleolin
  • Protein C23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43782
Species: Hu
Applications: WB
NBP1-91333
Species: Hu
Applications: WB
NBP2-39066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94150
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88271
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Nucleolin Antibody (NBP1-88271) (0)

There are no publications for Nucleolin Antibody (NBP1-88271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleolin Antibody (NBP1-88271) (0)

There are no reviews for Nucleolin Antibody (NBP1-88271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nucleolin Antibody (NBP1-88271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleolin Products

Bioinformatics Tool for Nucleolin Antibody (NBP1-88271)

Discover related pathways, diseases and genes to Nucleolin Antibody (NBP1-88271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleolin Antibody (NBP1-88271)

Discover more about diseases related to Nucleolin Antibody (NBP1-88271).
 

Pathways for Nucleolin Antibody (NBP1-88271)

View related products by pathway.

PTMs for Nucleolin Antibody (NBP1-88271)

Learn more about PTMs related to Nucleolin Antibody (NBP1-88271).
 

Research Areas for Nucleolin Antibody (NBP1-88271)

Find related products by research area.

Blogs on Nucleolin.

Nucleolin: A Multifaceted Nucleolar Phosphoprotein
Nucleolin is a ubiquitous, nonhistone nucleolar phosphoprotein of exponentially growing eukaryotic cells and is present in abundance at the dense fibrillar and granular regions of nucleolus. Intact nucleolin is the major species and represents 5% of n...  Read full blog post.

Nucleolin Antibodies: Knowing When it's Time to Split
Nucleolin is an abundant, 106 kDa nucleolar phosphoprotein that is a major protein in actively dividing cells. The stability of nucleolin is heavily cell proliferation-dependent, as nucleolin antibody studies have shown that degraded forms are relativ...  Read full blog post.

Nucleolin: To the Nucleus and Beyond!
Nucleolin is a multifunctional phosphoprotein ubiquitously distributed in the nucleolus, nucleus and cytoplasm of the cell. Nucleolin has a bipartite nuclear localization signal sequence and is conserved across the species. Nucleolin levels are expres...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleolin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCL