UBTF Antibody

Images

 
Western Blot: UBTF Antibody [NBP1-82545] - Analysis in mouse cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: UBTF Antibody [NBP1-82545] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human skin shows strong nuclear positivity in epidermal cells.
Western Blot: UBTF Antibody [NBP1-82545] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Western Blot: UBTF Antibody [NBP1-82545] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of mouse retrosplenial granular cortex shows nuclear neuronal positivity.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of mouse motor cortex shows nuclear positivity in neurons.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of mouse thalamus shows nuclear immunoreactivity in anterodorsal thalamic nucleus neurons.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human cerebral cortex shows nuclear positivity.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human cerebral cortex shows nuclear and cytoplasmic immunoreactivity in neurons.
Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human hippocampus shows nuclear immunoreactivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBTF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBTF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBTF Recombinant Protein Antigen (NBP1-82545PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-82545 in the following applications:

Publications
Read Publication using NBP1-82545.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24513678)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBTF Antibody

  • 90-KDa Nucleolus Organizer Region Autoantigen
  • Autoantigen NOR-90
  • NOR-90
  • nucleolar transcription factor 1
  • UBF
  • UBF1
  • UBF-1
  • UBF2
  • UBFUBF-1
  • upstream binding transcription factor, RNA polymerase I
  • Upstream-binding factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-12779
Species: Hu
Applications: WB, IP
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-89867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for UBTF Antibody (NBP1-82545)(1)

Review for UBTF Antibody (NBP1-82545) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-82545:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UBTF NBP1-82545
Enlarge
reviewed by:
Ashwini Katre
WB Human 07/24/2014
View

Summary

ApplicationWestern Blot
Sample TestedHuman ovarian carcinoma cell lines
SpeciesHuman
LotA79395

Blocking

Blocking Details5% nonfat dry milk made in TBST

Primary Anitbody

Dilution Ratio1:1000 in 5 % nonfat dry milk in TBST overnight at 4 degree

Secondary Antibody

Secondary Descriptionanti rabbit
Secondary Manufacturer Cat#7074S - cell signaling
Secondary Concentration1:2000 1 hr at RT

Details

Detection NotesECL- xray film exposed to film for 2 min

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBTF Antibody (NBP1-82545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBTF Products

Bioinformatics Tool for UBTF Antibody (NBP1-82545)

Discover related pathways, diseases and genes to UBTF Antibody (NBP1-82545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBTF Antibody (NBP1-82545)

Discover more about diseases related to UBTF Antibody (NBP1-82545).
 

Pathways for UBTF Antibody (NBP1-82545)

View related products by pathway.

PTMs for UBTF Antibody (NBP1-82545)

Learn more about PTMs related to UBTF Antibody (NBP1-82545).

Blogs on UBTF

There are no specific blogs for UBTF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Ashwini Katre
07/24/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol UBTF