Nucleobindin 1 Antibody

Images

 
Western Blot: Nucleobindin 1 Antibody [NBP1-88217] - Analysis in human cell line SiHa.
Immunocytochemistry/ Immunofluorescence: Nucleobindin 1 Antibody [NBP1-88217] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleobindin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGWETVEMHPAYTEEELRRFEEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDVPVPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUCB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nucleobindin 1 Protein (NBP1-88217PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleobindin 1 Antibody

  • DKFZp686A15286
  • FLJ40471
  • NUCCALNUC
  • nucleobindin 1
  • nucleobindin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00085015-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-88217
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nucleobindin 1 Antibody (NBP1-88217) (0)

There are no publications for Nucleobindin 1 Antibody (NBP1-88217).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleobindin 1 Antibody (NBP1-88217) (0)

There are no reviews for Nucleobindin 1 Antibody (NBP1-88217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nucleobindin 1 Antibody (NBP1-88217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleobindin 1 Products

Bioinformatics Tool for Nucleobindin 1 Antibody (NBP1-88217)

Discover related pathways, diseases and genes to Nucleobindin 1 Antibody (NBP1-88217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleobindin 1 Antibody (NBP1-88217)

Discover more about diseases related to Nucleobindin 1 Antibody (NBP1-88217).
 

Pathways for Nucleobindin 1 Antibody (NBP1-88217)

View related products by pathway.

PTMs for Nucleobindin 1 Antibody (NBP1-88217)

Learn more about PTMs related to Nucleobindin 1 Antibody (NBP1-88217).

Blogs on Nucleobindin 1

There are no specific blogs for Nucleobindin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleobindin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUCB1