NUBP2 Antibody - BSA Free

Western Blot: NUBP2 Antibody [NBP2-85410] - Host: Rabbit. Target Name: NUBP2. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NUBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUBP2 Antibody - BSA Free (NBP2-85410) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NUBP2. Peptide sequence: ELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRREL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NUBP2 Antibody - BSA Free

• CFD1C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) )
• cytosolic Fe-S cluster assembly factor NUBP2
• homolog of yeast cytosolic Fe-S cluster deficient 1
• NBP 2
• NUBP1
• nucleotide binding protein 2 (E.coli MinD like)
• nucleotide binding protein 2 (MinD homolog, E. coli)
• Nucleotide-binding protein 2

Background

NUBP2 is a member of the NUBP/MRP gene subfamily of ATP-binding proteins (see NUBP1; MIM 600280) (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUBP2