BRUNOL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BRUNOL4 Antibody [NBP1-89932] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRUNOL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
BRUNOL4 Protein (NBP1-89932PEP)
Publications
Read Publications using NBP1-89932.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23090952)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRUNOL4 Antibody

  • Bruno (Drosophila) -like 4, RNA binding protein
  • BRUNOL-4
  • BRUNOL4Bruno -like 4, RNA binding protein
  • bruno-like 4, RNA binding protein (Drosophila)
  • bruno-like 4, RNA binding protein
  • Bruno-like protein 4
  • CELF-4
  • CUG-BP and ETR-3 like factor 4
  • CUG-BP- and ETR-3-like factor 4
  • CUGBP Elav-like family member 4
  • CUGBP, Elav-like family member 4
  • LYST-interacting protein LIP9
  • RNA-binding protein BRUNOL4
  • RNA-binding protein BRUNOL-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16035
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-25959
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89933
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
MAB6967
Species: Hu
Applications: WB
NBP1-87115
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF753
Species: Mu
Applications: WB, IHC
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-2911
Species: Hu
Applications: WB, ICC/IF
NBP2-30728
Species: Hu
Applications: IHC, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-92204
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89932
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for BRUNOL4 Antibody (NBP1-89932)(2)

Reviews for BRUNOL4 Antibody (NBP1-89932) (0)

There are no reviews for BRUNOL4 Antibody (NBP1-89932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRUNOL4 Antibody (NBP1-89932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRUNOL4 Products

Bioinformatics Tool for BRUNOL4 Antibody (NBP1-89932)

Discover related pathways, diseases and genes to BRUNOL4 Antibody (NBP1-89932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRUNOL4 Antibody (NBP1-89932)

Discover more about diseases related to BRUNOL4 Antibody (NBP1-89932).
 

Pathways for BRUNOL4 Antibody (NBP1-89932)

View related products by pathway.

Blogs on BRUNOL4

There are no specific blogs for BRUNOL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRUNOL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELF4