BRUNOL4 Antibody


Immunocytochemistry/ Immunofluorescence: BRUNOL4 Antibody [NBP1-89932] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

BRUNOL4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Specificity of human BRUNOL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
BRUNOL4 Protein (NBP1-89932PEP)
Read Publications using NBP1-89932.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23090952)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BRUNOL4 Antibody

  • Bruno (Drosophila) -like 4, RNA binding protein
  • BRUNOL-4
  • BRUNOL4Bruno -like 4, RNA binding protein
  • bruno-like 4, RNA binding protein (Drosophila)
  • bruno-like 4, RNA binding protein
  • Bruno-like protein 4
  • CELF-4
  • CUG-BP and ETR-3 like factor 4
  • CUG-BP- and ETR-3-like factor 4
  • CUGBP Elav-like family member 4
  • CUGBP, Elav-like family member 4
  • LYST-interacting protein LIP9
  • RNA-binding protein BRUNOL4
  • RNA-binding protein BRUNOL-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BRUNOL4 Antibody (NBP1-89932)(2)

Reviews for BRUNOL4 Antibody (NBP1-89932) (0)

There are no reviews for BRUNOL4 Antibody (NBP1-89932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRUNOL4 Antibody (NBP1-89932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRUNOL4 Products

Bioinformatics Tool for BRUNOL4 Antibody (NBP1-89932)

Discover related pathways, diseases and genes to BRUNOL4 Antibody (NBP1-89932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRUNOL4 Antibody (NBP1-89932)

Discover more about diseases related to BRUNOL4 Antibody (NBP1-89932).

Pathways for BRUNOL4 Antibody (NBP1-89932)

View related products by pathway.

Blogs on BRUNOL4

There are no specific blogs for BRUNOL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRUNOL4 Antibody and receive a gift card or discount.


Gene Symbol CELF4