NUBP1 Antibody

Images

 
Independent Antibodies: Western Blot: NUBP1 Antibody [NBP1-92204] - Analysis using Anti-NUBP1 antibody NBP1-92204 (A) shows similar pattern to independent antibody NBP1-92205 (B).
Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human colon.
Genetic Strategies: Western Blot: NUBP1 Antibody [NBP1-92204] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human testis shows moderate cytoplasmic positivity in cells in exocrine glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human colon, kidney, liver and testis using Anti-NUBP1 antibody NBP1-92204 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human liver.
Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human kidney.
Immunohistochemistry-Paraffin: NUBP1 Antibody [NBP1-92204] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN
Specificity
Specificity of human NUBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP1-92204 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%). Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUBP1 Antibody

  • cytosolic Fe-S cluster assembly factor NUBP1
  • MGC117406
  • MGC130053
  • NBP 1
  • NBP1
  • NBPMGC130052
  • nucleotide binding protein (e.coli MinD like)
  • nucleotide binding protein 1 (E.coli MinD like)
  • nucleotide binding protein 1 (MinD homolog, E. coli)
  • Nucleotide-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: WB, IP
NBP1-83289
Species: Hu
Applications: WB, IHC, IHC-P
H00007884-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NBP2-14977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
7270-IL/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-84533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-92204
Species: Hu
Applications: WB, IHC, IHC-P, KD

Publications for NUBP1 Antibody (NBP1-92204)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for NUBP1 Antibody (NBP1-92204) (0)

There are no reviews for NUBP1 Antibody (NBP1-92204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUBP1 Antibody (NBP1-92204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUBP1 Products

Bioinformatics Tool for NUBP1 Antibody (NBP1-92204)

Discover related pathways, diseases and genes to NUBP1 Antibody (NBP1-92204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUBP1 Antibody (NBP1-92204)

Discover more about diseases related to NUBP1 Antibody (NBP1-92204).
 

Pathways for NUBP1 Antibody (NBP1-92204)

View related products by pathway.

PTMs for NUBP1 Antibody (NBP1-92204)

Learn more about PTMs related to NUBP1 Antibody (NBP1-92204).

Blogs on NUBP1

There are no specific blogs for NUBP1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUBP1