Home » NTB-A/SLAMF6/CD352 » NTB-A/SLAMF6/CD352 Antibodies » NTB-A/SLAMF6/CD352 Antibody

NTB-A/SLAMF6/CD352 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NTB-A/SLAMF6/CD352 Antibody [H00114836-B01P] - Analysis of SLAMF6 expression in human spleen.
Western Blot: NTB-A/SLAMF6/CD352 Antibody [H00114836-B01P] - Analysis of SLAMF6 expression in human spleen.
Western Blot: NTB-A/SLAMF6/CD352 Antibody [H00114836-B01P] - Analysis of SLAMF6 expression in transfected 293T cell line by SLAMF6 polyclonal antibody. Lane 1: SLAMF6 transfected lysate(29.81 KDa). Lane 2: ...read more

Product Details

Summary
Product Discontinued
View other related NTB-A/SLAMF6/CD352 Primary Antibodies

Order Details


    • Catalog Number
      H00114836-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NTB-A/SLAMF6/CD352 Antibody Summary

Immunogen
SLAMF6 (AAH90928.1, 1 a.a. - 271 a.a.) full-length human protein. MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS
Specificity
SLAMF6 - SLAM family member 6,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLAMF6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NTB-A/SLAMF6/CD352 Antibody

  • Activating NK receptor
  • CD352 antigen
  • CD352
  • KALIFLJ50657
  • Ly108
  • NK-T-B-antigen
  • NTBA receptor
  • NTBA
  • NTB-A
  • NTB-AMGC104953
  • NTBAT- and B-cell antigen
  • SF2000
  • SLAM family member 6
  • SLAMF6

Background

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - Analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.Lane 1: SH2D1A transfected lysate(14.2 KDa).Lane 2: Non-transfected lysate.
Flow Cytometry: SH2D1A Antibody (1C9) [H00004068-M01] - Intracellular staining of human T cells with SH2D1A monoclonal antibody or isotype control antibody, followed by a Polyclonal Goat Anti-Mouse/RPE secondary antibody. Grey filled histogram: Isotype control, empty blue histogram: SH2D1A antibody. Flow cytometry image submitted by a verified customer review.
Western Blot: SH2D1A Antibody (1C9) [H00004068-M01] - SH2D1A monoclonal antibody (M01), clone 1C9 Analysis of SH2D1A expression in Jurkat.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
SLAM/CD150 Antibody
NBP1-76555
Western Blot: SLAM/CD150 Antibody [NBP1-76555] - Rat colon tissue lysate with SLAM antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: SLAM/CD150 Antibody [NBP1-76555] - Immunofluorescence of SLAM in human colon tissue with SLAM antibody at 20 ug/mL.
Immunohistochemistry: SLAM/CD150 Antibody [NBP1-76555] - Immunohistochemistry of SLAMF1 in human colon tissue with SLAMF1 antibody at 5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NKG2D/CD314
Antibody (149810) [Un ...
MAB139
Human peripheral blood mononuclear cells (PBMCs) gated on CD3- cells were stained with Mouse Anti-Human NCAM‑1/CD56 APC‑conjugated Monoclonal Antibody (Catalog # FAB2408A) and either (A) Mouse Anti-Human NKG2D/CD314 Monoclonal Antibody (Catalog # MAB139) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by anti-Mouse IgG PE-conjugated Monoclonal Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Review)
(70 Publications)
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut

CD229/SLAMF3/Lymphocyt ...
MAB2555
Mouse splenocytes were stained with Rat Anti-Mouse CD229/SLAMF3 Monoclonal Antibody (Catalog # MAB2555, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram), followed by Phycoerythrin-conjugated Anti-Rat IgG F(ab')2 Secondary Antibody (Catalog # F0105B).
Species: Mu
Applications: WB, Flow, CyTOF-ready
CRACC/SLAMF7
Antibody (OTI1F1) - A ...
NBP2-72107
Western Blot: CRACC/SLAMF7 Antibody (OTI1F1) - Azide and BSA Free [NBP2-72107] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLAMF7 (RC220985, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLAMF7. Positive lysates (100ug) and (20ug).
Immunohistochemistry: CRACC/SLAMF7 Antibody (OTI1F1) - Azide and BSA Free [NBP2-72107] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry-Paraffin: CRACC/SLAMF7 Antibody (OTI1F1) - Azide and BSA Free [NBP2-72107] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-SLAMF7 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120 degrees C for 3min.
Species: Hu
Applications: WB, IHC, IHC-P
CD48/SLAMF2
Antibody [Unconjugate
AF3327
CD48/SLAMF2 was detected in immersion fixed mouse splenocytes using Goat Anti-Mouse CD48/SLAMF2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3327) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
2B4/CD244/SLAMF4
Antibody [Unconjugate ...
AF1039
Western blot shows lysates of NK‑RL human natural killer lymphocytic leukemia cell line, NK‑92 human natural killer lymphoma cell line, and Daudi human Burkitt's lymphoma cell line (negative control). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human 2B4/CD244/SLAMF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1039) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for 2B4/CD244/SLAMF4 at approximately 65 kDa (as indicated). GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human NCAM‑1/CD56 APC‑conjugated Monoclonal Antibody (Catalog # FAB2408A) and either (A) Goat Anti-Human 2B4/CD244/SLAMF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1039) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).
2B4/CD244/SLAMF4 was detected in immersion fixed paraffin-embedded sections of human spleen using Goat Anti-Human 2B4/CD244/SLAMF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1039) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to splenocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Publications)
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Pentraxin 2/SAP
Antibody [Unconjugate
AF2558
Western blot shows lysates of mouse kidney tissue, mouse liver tissue, and human kidney tissue. PVDF membrane was probed with 0.2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Pentraxin 2/SAP at approximately 26 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for Pentraxin 2/SAP at approximately 36 kDa (as indicated) using 2 µg/mL of Sheep Anti-Human/Mouse Pentraxin 2/SAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2558) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western
CD84/SLAMF5
Antibody (152-1D5)
NBP2-44345
Flow Cytometry: CD84/SLAMF5 Antibody (152-1D5) [NBP2-44345] - Flow Cytometric Analysis of PFA-fixed MOLT-4 cells. CD84/SLAMF5 Antibody (152-1D5) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Species: Hu
Applications: Flow, IF
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NKp30/NCR3
1849-NK
NKp30/NCR3
(18 Publications)
Species: Hu
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
GITR/TNFRSF18
Antibody (110416) [Un ...
MAB689
GITR/TNFRSF18 Antibody (110416) [Unconjugated]
(1 Review)
(9 Publications)
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
HVEM/TNFRSF14
Antibody (94801) [Unc ...
MAB356
Human peripheral blood lymphocytes were stained with Mouse Anti-Human HVEM/TNFRSF14 Monoclonal Antibody (Catalog # MAB356, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
(4 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
CD2 Antibody
(3D1E3)
NBP2-61727
Western Blot: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis using CD2 mAb against HEK293 (1) and CD2 (AA: 25-140)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry-Paraffin: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis of endometrial cancer tissues using CD2 mouse mAb with DAB staining.
Flow Cytometry: CD2 Antibody (3D1E3) [NBP2-61727] - Analysis of HepG2 cells using CD2 mouse mAb (green) and negative control (red).
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, MiAr
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(335 Publications)
Species: Hu
NTB-A/SLAMF6/CD352
Antibody
H00114836-B01P
NTB-A/SLAMF6/CD352 Antibody
Species: Hu
Applications: WB

Publications for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no publications for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no reviews for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NTB-A/SLAMF6/CD352 Products

Bioinformatics Tool for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

Discover related pathways, diseases and genes to NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

Discover more about diseases related to NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P).
 

Pathways for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

View related products by pathway.

Blogs on NTB-A/SLAMF6/CD352

There are no specific blogs for NTB-A/SLAMF6/CD352, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTB-A/SLAMF6/CD352 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLAMF6
Entrez