NTB-A/SLAMF6/CD352 Antibody

Images

 
Western Blot: NTB-A/SLAMF6/CD352 Antibody [H00114836-B01P] - Analysis of SLAMF6 expression in human spleen.
Western Blot: NTB-A/SLAMF6/CD352 Antibody [H00114836-B01P] - Analysis of SLAMF6 expression in transfected 293T cell line by SLAMF6 polyclonal antibody. Lane 1: SLAMF6 transfected lysate(29.81 KDa). Lane 2: ...read more

Product Details

Summary
Product Discontinued
View other related NTB-A/SLAMF6/CD352 Primary Antibodies

Order Details


    • Catalog Number
      H00114836-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NTB-A/SLAMF6/CD352 Antibody Summary

Immunogen
SLAMF6 (AAH90928.1, 1 a.a. - 271 a.a.) full-length human protein. MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPGEHSDS
Specificity
SLAMF6 - SLAM family member 6,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLAMF6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NTB-A/SLAMF6/CD352 Antibody

  • Activating NK receptor
  • CD352 antigen
  • CD352
  • KALIFLJ50657
  • Ly108
  • NK-T-B-antigen
  • NTBA receptor
  • NTBA
  • NTB-A
  • NTB-AMGC104953
  • NTBAT- and B-cell antigen
  • SF2000
  • SLAM family member 6
  • SLAMF6

Background

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, Func, S-ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-76555
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-72107
Species: Hu
Applications: WB, IHC, IHC-P
AF3327
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-44345
Species: Hu
Applications: Flow, IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
1849-NK
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB356
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-61727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, MiAr
H00114836-B01P
Species: Hu
Applications: WB

Publications for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no publications for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no reviews for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NTB-A/SLAMF6/CD352 Products

Bioinformatics Tool for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

Discover related pathways, diseases and genes to NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

Discover more about diseases related to NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P).
 

Pathways for NTB-A/SLAMF6/CD352 Antibody (H00114836-B01P)

View related products by pathway.

Blogs on NTB-A/SLAMF6/CD352

There are no specific blogs for NTB-A/SLAMF6/CD352, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTB-A/SLAMF6/CD352 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLAMF6
Entrez