NSMAF Antibody

Images

 
Immunohistochemistry-Paraffin: NSMAF Antibody [NBP1-84737] - Staining of human tonsil shows moderate cytoplasmic positivity in both germinal and non-germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NSMAF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAEHTAESY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSMAF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NSMAF Protein (NBP1-84737PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSMAF Antibody

  • Factor associated with neutral sphingomyelinase activation
  • FANFactor associated with N-SMase activation
  • neutral sphingomyelinase (N-SMase) activation associated factor
  • protein FAN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84737
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NSMAF Antibody (NBP1-84737) (0)

There are no publications for NSMAF Antibody (NBP1-84737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSMAF Antibody (NBP1-84737) (0)

There are no reviews for NSMAF Antibody (NBP1-84737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NSMAF Antibody (NBP1-84737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NSMAF Products

Bioinformatics Tool for NSMAF Antibody (NBP1-84737)

Discover related pathways, diseases and genes to NSMAF Antibody (NBP1-84737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSMAF Antibody (NBP1-84737)

Discover more about diseases related to NSMAF Antibody (NBP1-84737).
 

Pathways for NSMAF Antibody (NBP1-84737)

View related products by pathway.

PTMs for NSMAF Antibody (NBP1-84737)

Learn more about PTMs related to NSMAF Antibody (NBP1-84737).

Blogs on NSMAF

There are no specific blogs for NSMAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSMAF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSMAF